Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4031289..4031839 Replicon chromosome
Accession NZ_CP125220
Organism Salmonella enterica subsp. enterica serovar Enteritidis strain sm140

Toxin (Protein)


Gene name ccdB Uniprot ID M7RJ32
Locus tag QK897_RS19680 Protein ID WP_001199743.1
Coordinates 4031289..4031597 (-) Length 103 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID M7RP97
Locus tag QK897_RS19685 Protein ID WP_001118105.1
Coordinates 4031600..4031839 (-) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QK897_RS19660 (4027863) 4027863..4028603 - 741 WP_001676217.1 SEF14/SEF18 fimbria chaperone SefB -
QK897_RS19665 (4028725) 4028725..4029255 - 531 WP_000909461.1 SEF14 fimbria major subunit SefA -
QK897_RS19670 (4029578) 4029578..4030711 + 1134 Protein_3845 IS3 family transposase -
QK897_RS19675 (4030743) 4030743..4030883 - 141 Protein_3846 Arm DNA-binding domain-containing protein -
QK897_RS19680 (4031289) 4031289..4031597 - 309 WP_001199743.1 CcdB family protein Toxin
QK897_RS19685 (4031600) 4031600..4031839 - 240 WP_001118105.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
QK897_RS19690 (4031948) 4031948..4032196 - 249 WP_000168388.1 ribbon-helix-helix domain-containing protein -
QK897_RS19695 (4032387) 4032387..4032818 - 432 Protein_3850 helix-turn-helix domain-containing protein -
QK897_RS19705 (4033575) 4033575..4034594 + 1020 WP_000152558.1 NAD(P)-dependent alcohol dehydrogenase -
QK897_RS19710 (4034622) 4034622..4035152 - 531 WP_000896758.1 gluconokinase -
QK897_RS19715 (4035369) 4035369..4036400 + 1032 WP_000453347.1 L-idonate 5-dehydrogenase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside IScluster/Tn - - 4029670..4032773 3103


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-101)

Antitoxin

Post-segregation antitoxin CcdA

(9-79)


Sequences

Toxin        


Download         Length: 103 a.a.        Molecular weight: 11845.67 Da        Isoelectric Point: 6.7228

>T281937 WP_001199743.1 NZ_CP125220:c4031597-4031289 [Salmonella enterica subsp. enterica serovar Enteritidis]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF

Download         Length: 309 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8719.90 Da        Isoelectric Point: 6.4633

>AT281937 WP_001118105.1 NZ_CP125220:c4031839-4031600 [Salmonella enterica subsp. enterica serovar Enteritidis]
MPGMSVRHKKTVSVTLEPALLQQARDAGINLSAVLTAALKEEISATGVERWKAENRAGLQELNRITDEHGLLSDDYRTF

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6C6Z9V9

Antitoxin

Source ID Structure
AlphaFold DB A0A5H9SZK8

References