Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3411500..3412120 | Replicon | chromosome |
| Accession | NZ_CP125220 | ||
| Organism | Salmonella enterica subsp. enterica serovar Enteritidis strain sm140 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | QK897_RS16815 | Protein ID | WP_001280991.1 |
| Coordinates | 3411902..3412120 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | QK897_RS16810 | Protein ID | WP_000344807.1 |
| Coordinates | 3411500..3411874 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QK897_RS16800 (3406639) | 3406639..3407832 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| QK897_RS16805 (3407855) | 3407855..3411004 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
| QK897_RS16810 (3411500) | 3411500..3411874 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| QK897_RS16815 (3411902) | 3411902..3412120 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| QK897_RS16820 (3412299) | 3412299..3412850 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
| QK897_RS16825 (3412968) | 3412968..3413438 | + | 471 | WP_000136183.1 | YlaC family protein | - |
| QK897_RS16830 (3413494) | 3413494..3413634 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| QK897_RS16835 (3413640) | 3413640..3413900 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
| QK897_RS16840 (3414125) | 3414125..3415675 | + | 1551 | WP_000213140.1 | EAL domain-containing protein | - |
| QK897_RS16850 (3415906) | 3415906..3416295 | + | 390 | WP_000961287.1 | MGMT family protein | - |
| QK897_RS16855 (3416328) | 3416328..3416897 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T281933 WP_001280991.1 NZ_CP125220:3411902-3412120 [Salmonella enterica subsp. enterica serovar Enteritidis]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT281933 WP_000344807.1 NZ_CP125220:3411500-3411874 [Salmonella enterica subsp. enterica serovar Enteritidis]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|