Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yoeB-relB/YoeB-YefM
Location 880594..881096 Replicon chromosome
Accession NZ_CP125110
Organism Stenotrophomonas acidaminiphila strain SPDF1

Toxin (Protein)


Gene name yoeB Uniprot ID Q5XQD8
Locus tag QLF99_RS03875 Protein ID WP_032492620.1
Coordinates 880594..880848 (-) Length 85 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A1V0BEH6
Locus tag QLF99_RS03880 Protein ID WP_032492621.1
Coordinates 880845..881096 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QLF99_RS03845 (QLF99_03845) 876542..876763 - 222 Protein_746 tyrosine-type recombinase/integrase -
QLF99_RS03850 (QLF99_03850) 876829..877533 + 705 WP_001067855.1 IS6-like element IS26 family transposase -
QLF99_RS03855 (QLF99_03855) 877586..878383 - 798 Protein_748 class 1 integron integrase IntI1 -
QLF99_RS03860 (QLF99_03860) 878634..878966 + 333 WP_015243636.1 quaternary ammonium compound efflux SMR transporter QacF -
QLF99_RS03865 (QLF99_03865) 879055..879609 + 555 WP_003159191.1 aminoglycoside N-acetyltransferase AAC(6')-Ib4 -
QLF99_RS03870 (QLF99_03870) 879680..880474 + 795 WP_282884199.1 aminoglycoside O-phosphotransferase APH(3')-XV -
QLF99_RS03875 (QLF99_03875) 880594..880848 - 255 WP_032492620.1 Txe/YoeB family addiction module toxin Toxin
QLF99_RS03880 (QLF99_03880) 880845..881096 - 252 WP_032492621.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
QLF99_RS03885 (QLF99_03885) 881280..881912 + 633 WP_000186237.1 type B-3 chloramphenicol O-acetyltransferase CatB3 -
QLF99_RS03890 (QLF99_03890) 882031..882861 + 831 WP_001334766.1 oxacillin-hydrolyzing class D beta-lactamase OXA-1 -
QLF99_RS03895 (QLF99_03895) 882974..883812 + 839 Protein_756 AadA family aminoglycoside 3''-O-nucleotidyltransferase -
QLF99_RS03900 (QLF99_03900) 883929..884276 + 348 WP_000679427.1 quaternary ammonium compound efflux SMR transporter QacE delta 1 -
QLF99_RS03905 (QLF99_03905) 884270..885109 + 840 WP_000259031.1 sulfonamide-resistant dihydropteroate synthase Sul1 -
QLF99_RS03910 (QLF99_03910) 885237..885737 + 501 WP_000376623.1 GNAT family N-acetyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island aph(3')-XV / catB3 / blaOXA-1 / aadA17 / sul1 - 871995..887008 15013
- inside IScluster/Tn aph(3')-XV / catB3 / blaOXA-1 / aadA17 / sul1 - 875567..887008 11441
- inside Integron aadA17 / catB3 / aph(3')-XV / blaOXA-1 - 877424..883826 6402


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(5-84)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-74)


Sequences

Toxin        


Download         Length: 85 a.a.        Molecular weight: 10272.81 Da        Isoelectric Point: 9.3585

>T281920 WP_032492620.1 NZ_CP125110:c880848-880594 [Stenotrophomonas acidaminiphila]
MRLIFSDDAWEDYLFWQKQDRRMVDRINKLIKETTREPFSGVGKPEPLKHALAGYWSRRITDEHRMVYKVADDALWIVQL
KYHY

Download         Length: 255 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9244.40 Da        Isoelectric Point: 4.7769

>AT281920 WP_032492621.1 NZ_CP125110:c881096-880845 [Stenotrophomonas acidaminiphila]
MDAITYTHARANLAGTMDRVCNDHEPVIITRNGDQSVVILSLEDFQALEETAYLLRSPANAKRLFKSIEQLEAGRGQARE
LAE

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1V0BEH9

Antitoxin

Source ID Structure
AlphaFold DB A0A1V0BEH6

References