Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) pasABC/RelE-HTH
Location 325696..326182 Replicon chromosome
Accession NZ_CP125094
Organism Agrobacterium fabrum strain N33/94

Toxin (Protein)


Gene name pasB Uniprot ID -
Locus tag G6L76_RS01565 Protein ID WP_080812136.1
Coordinates 325696..325965 (-) Length 90 a.a.

Antitoxin (Protein)


Gene name pasA Uniprot ID A0A7Z7BLB4
Locus tag G6L76_RS01570 Protein ID WP_006313156.1
Coordinates 325949..326182 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
G6L76_RS01535 (G6L76_001535) 320747..321523 - 777 WP_006313140.1 L,D-transpeptidase -
G6L76_RS01540 (G6L76_001540) 321762..322391 + 630 WP_006313142.1 DNA-3-methyladenine glycosylase I -
G6L76_RS01545 (G6L76_001545) 322388..322831 + 444 WP_006313144.1 hypothetical protein -
G6L76_RS01550 (G6L76_001550) 322857..323900 - 1044 WP_035256280.1 YeiH family protein -
G6L76_RS01555 (G6L76_001555) 323982..324899 + 918 WP_010971057.1 LysR family transcriptional regulator -
G6L76_RS01560 (G6L76_001560) 324925..325689 - 765 WP_080810439.1 hypothetical protein -
G6L76_RS01565 (G6L76_001565) 325696..325965 - 270 WP_080812136.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
G6L76_RS01570 (G6L76_001570) 325949..326182 - 234 WP_006313156.1 DUF6290 family protein Antitoxin
G6L76_RS01575 (G6L76_001575) 326339..327862 + 1524 WP_080810435.1 histidine--tRNA ligase -
G6L76_RS01580 (G6L76_001580) 327867..328235 + 369 WP_080810433.1 VOC family protein -
G6L76_RS01585 (G6L76_001585) 328252..329379 + 1128 WP_080810430.1 ATP phosphoribosyltransferase regulatory subunit -
G6L76_RS01590 (G6L76_001590) 329376..330068 + 693 WP_080810428.1 ATP phosphoribosyltransferase -
G6L76_RS01595 (G6L76_001595) 330133..330579 - 447 WP_006313161.1 DoxX family protein -
G6L76_RS01600 (G6L76_001600) 330735..331154 - 420 WP_230060738.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-88)

Antitoxin

Protein of unknown function DUF6290

(6-73)


Sequences

Toxin        


Download         Length: 90 a.a.        Molecular weight: 10436.96 Da        Isoelectric Point: 10.0416

>T281916 WP_080812136.1 NZ_CP125094:c325965-325696 [Agrobacterium fabrum]
MIWRIEFQRNAVKQLGKLTKSDANRIVSFLTDRVAQDDNPRRAGAALQGSELGNFWHYRVGDYRIICDIQDHKLVVLVVE
IGHRREIYR

Download         Length: 270 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 9223.39 Da        Isoelectric Point: 4.7543

>AT281916 WP_006313156.1 NZ_CP125094:c326182-325949 [Agrobacterium fabrum]
MSKQTAIRLPDETYERLKALSERTGRTSAYYIREAIEKHIEDMEDLYLAEEAMRKHIANKERTYTLEEVMRDLDLEN

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A7Z7BLB4

References