Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relB-parE/ParE-RHH |
Location | 1068..1648 | Replicon | plasmid pBAK085d |
Accession | NZ_CP125092 | ||
Organism | Klebsiella pneumoniae strain BAK085 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A060VNB1 |
Locus tag | QJS47_RS27785 | Protein ID | WP_001136729.1 |
Coordinates | 1334..1648 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A2X1PRM1 |
Locus tag | QJS47_RS27780 | Protein ID | WP_000093040.1 |
Coordinates | 1068..1346 (+) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJS47_RS27770 (QJS47_27770) | 140..511 | + | 372 | WP_001237044.1 | cell envelope integrity protein TolA | - |
QJS47_RS27775 (QJS47_27775) | 508..726 | + | 219 | WP_002193751.1 | TonB family protein | - |
QJS47_RS27780 (QJS47_27780) | 1068..1346 | + | 279 | WP_000093040.1 | CopG family ribbon-helix-helix protein | Antitoxin |
QJS47_RS27785 (QJS47_27785) | 1334..1648 | + | 315 | WP_001136729.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QJS47_RS27790 (QJS47_27790) | 1812..2240 | + | 429 | WP_001140599.1 | hypothetical protein | - |
QJS47_RS27795 (QJS47_27795) | 2266..2445 | + | 180 | WP_065521055.1 | Rop family plasmid primer RNA-binding protein | - |
QJS47_RS27800 (QJS47_27800) | 2473..3003 | - | 531 | WP_065521056.1 | hypothetical protein | - |
QJS47_RS27805 (QJS47_27805) | 3010..3741 | - | 732 | WP_032448355.1 | MobC family replication-relaxation protein | - |
QJS47_RS27810 (QJS47_27810) | 3741..5702 | - | 1962 | WP_202179206.1 | TraM recognition domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..10078 | 10078 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11847.77 Da Isoelectric Point: 9.8619
>T281914 WP_001136729.1 NZ_CP125092:1334-1648 [Klebsiella pneumoniae]
MPQVTISALAQRDLQRLQDFLKTKNRLAARKAGEVIVRAIQQLKTLPDIGRPVPFLPLEYQELVIGFGDSGYVMLYRHDR
EMDRIVIVTVRHQKESGYPGADSL
MPQVTISALAQRDLQRLQDFLKTKNRLAARKAGEVIVRAIQQLKTLPDIGRPVPFLPLEYQELVIGFGDSGYVMLYRHDR
EMDRIVIVTVRHQKESGYPGADSL
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A060VNB1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2X1PRM1 |