281912

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 5880..6405 Replicon plasmid pBAK085a
Accession NZ_CP125089
Organism Klebsiella pneumoniae strain BAK085

Toxin (Protein)


Gene name ccdB Uniprot ID D4HQE7
Locus tag QJS47_RS26240 Protein ID WP_013023785.1
Coordinates 5880..6185 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID W8V2V6
Locus tag QJS47_RS26245 Protein ID WP_001568025.1
Coordinates 6187..6405 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJS47_RS26210 (QJS47_26210) 1551..2177 + 627 WP_004197649.1 ParA family plasmid-partitioning AAA ATPase -
QJS47_RS26215 (QJS47_26215) 2174..2476 + 303 WP_004197636.1 hypothetical protein -
QJS47_RS26220 (QJS47_26220) 2956..3750 - 795 WP_004197635.1 site-specific integrase -
QJS47_RS26225 (QJS47_26225) 3948..4964 - 1017 WP_017899884.1 hypothetical protein -
QJS47_RS26230 (QJS47_26230) 4975..5289 - 315 WP_053389906.1 hypothetical protein -
QJS47_RS26235 (QJS47_26235) 5316..5711 - 396 WP_017899885.1 hypothetical protein -
QJS47_RS26240 (QJS47_26240) 5880..6185 - 306 WP_013023785.1 type II toxin-antitoxin system toxin CcdB Toxin
QJS47_RS26245 (QJS47_26245) 6187..6405 - 219 WP_001568025.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
QJS47_RS26250 (QJS47_26250) 6575..7036 - 462 WP_160866775.1 hypothetical protein -
QJS47_RS26255 (QJS47_26255) 6993..7223 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin -
QJS47_RS26260 (QJS47_26260) 7220..7636 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin -
QJS47_RS26265 (QJS47_26265) 7710..9272 + 1563 WP_004206609.1 AAA family ATPase -
QJS47_RS26270 (QJS47_26270) 9257..10279 + 1023 WP_000361404.1 helicase UvrD -
QJS47_RS26275 (QJS47_26275) 10535..11232 + 698 WP_223174630.1 IS1 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaKPC-2 / blaCTX-M-14 / blaTEM-1C - 1..113626 113626


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11615.30 Da        Isoelectric Point: 6.4672

>T281912 WP_013023785.1 NZ_CP125089:c6185-5880 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8392.34 Da        Isoelectric Point: 4.7405

>AT281912 WP_001568025.1 NZ_CP125089:c6405-6187 [Klebsiella pneumoniae]
MKQRITVTIDSDSYQLLKSADVNISALVNRAMQNEARRLRSERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2J4ZZW6

Antitoxin

Source ID Structure
AlphaFold DB A0A2J4ZZP8

References