Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 5880..6405 | Replicon | plasmid pBAK085a |
| Accession | NZ_CP125089 | ||
| Organism | Klebsiella pneumoniae strain BAK085 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | D4HQE7 |
| Locus tag | QJS47_RS26240 | Protein ID | WP_013023785.1 |
| Coordinates | 5880..6185 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | W8V2V6 |
| Locus tag | QJS47_RS26245 | Protein ID | WP_001568025.1 |
| Coordinates | 6187..6405 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJS47_RS26210 (QJS47_26210) | 1551..2177 | + | 627 | WP_004197649.1 | ParA family plasmid-partitioning AAA ATPase | - |
| QJS47_RS26215 (QJS47_26215) | 2174..2476 | + | 303 | WP_004197636.1 | hypothetical protein | - |
| QJS47_RS26220 (QJS47_26220) | 2956..3750 | - | 795 | WP_004197635.1 | site-specific integrase | - |
| QJS47_RS26225 (QJS47_26225) | 3948..4964 | - | 1017 | WP_017899884.1 | hypothetical protein | - |
| QJS47_RS26230 (QJS47_26230) | 4975..5289 | - | 315 | WP_053389906.1 | hypothetical protein | - |
| QJS47_RS26235 (QJS47_26235) | 5316..5711 | - | 396 | WP_017899885.1 | hypothetical protein | - |
| QJS47_RS26240 (QJS47_26240) | 5880..6185 | - | 306 | WP_013023785.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| QJS47_RS26245 (QJS47_26245) | 6187..6405 | - | 219 | WP_001568025.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| QJS47_RS26250 (QJS47_26250) | 6575..7036 | - | 462 | WP_160866775.1 | hypothetical protein | - |
| QJS47_RS26255 (QJS47_26255) | 6993..7223 | + | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| QJS47_RS26260 (QJS47_26260) | 7220..7636 | + | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | - |
| QJS47_RS26265 (QJS47_26265) | 7710..9272 | + | 1563 | WP_004206609.1 | AAA family ATPase | - |
| QJS47_RS26270 (QJS47_26270) | 9257..10279 | + | 1023 | WP_000361404.1 | helicase UvrD | - |
| QJS47_RS26275 (QJS47_26275) | 10535..11232 | + | 698 | WP_223174630.1 | IS1 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaKPC-2 / blaCTX-M-14 / blaTEM-1C | - | 1..113626 | 113626 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11615.30 Da Isoelectric Point: 6.4672
>T281912 WP_013023785.1 NZ_CP125089:c6185-5880 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J4ZZW6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J4ZZP8 |