Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 5247963..5248588 | Replicon | chromosome |
Accession | NZ_CP125088 | ||
Organism | Klebsiella pneumoniae strain BAK085 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | R4Y4A3 |
Locus tag | QJS47_RS25840 | Protein ID | WP_002882817.1 |
Coordinates | 5247963..5248346 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | J2DFR0 |
Locus tag | QJS47_RS25845 | Protein ID | WP_004150355.1 |
Coordinates | 5248346..5248588 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJS47_RS25825 (QJS47_25825) | 5245329..5246231 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
QJS47_RS25830 (QJS47_25830) | 5246228..5246863 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
QJS47_RS25835 (QJS47_25835) | 5246860..5247789 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
QJS47_RS25840 (QJS47_25840) | 5247963..5248346 | - | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QJS47_RS25845 (QJS47_25845) | 5248346..5248588 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
QJS47_RS25850 (QJS47_25850) | 5248793..5249710 | + | 918 | WP_002882812.1 | alpha/beta hydrolase | - |
QJS47_RS25855 (QJS47_25855) | 5249724..5250665 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
QJS47_RS25860 (QJS47_25860) | 5250710..5251147 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
QJS47_RS25865 (QJS47_25865) | 5251144..5252004 | - | 861 | WP_002882807.1 | virulence factor BrkB family protein | - |
QJS47_RS25870 (QJS47_25870) | 5251998..5252597 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T281911 WP_002882817.1 NZ_CP125088:c5248346-5247963 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GPK8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GGU9 |