Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4068360..4068979 | Replicon | chromosome |
Accession | NZ_CP125088 | ||
Organism | Klebsiella pneumoniae strain BAK085 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | QJS47_RS20170 | Protein ID | WP_002892050.1 |
Coordinates | 4068761..4068979 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | J2DPF6 |
Locus tag | QJS47_RS20165 | Protein ID | WP_002892066.1 |
Coordinates | 4068360..4068734 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJS47_RS20155 (QJS47_20155) | 4063512..4064705 | + | 1194 | WP_002892072.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
QJS47_RS20160 (QJS47_20160) | 4064728..4067874 | + | 3147 | WP_020326861.1 | multidrug efflux RND transporter permease subunit AcrB | - |
QJS47_RS20165 (QJS47_20165) | 4068360..4068734 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
QJS47_RS20170 (QJS47_20170) | 4068761..4068979 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
QJS47_RS20175 (QJS47_20175) | 4069138..4069704 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
QJS47_RS20180 (QJS47_20180) | 4069676..4069816 | - | 141 | WP_004147370.1 | hypothetical protein | - |
QJS47_RS20185 (QJS47_20185) | 4069837..4070307 | + | 471 | WP_002892026.1 | YlaC family protein | - |
QJS47_RS20190 (QJS47_20190) | 4070282..4071733 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
QJS47_RS20195 (QJS47_20195) | 4071834..4072532 | + | 699 | WP_002892021.1 | GNAT family protein | - |
QJS47_RS20200 (QJS47_20200) | 4072529..4072669 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
QJS47_RS20205 (QJS47_20205) | 4072669..4072932 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T281907 WP_002892050.1 NZ_CP125088:4068761-4068979 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT281907 WP_002892066.1 NZ_CP125088:4068360-4068734 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GJ93 |