Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4068360..4068979 Replicon chromosome
Accession NZ_CP125088
Organism Klebsiella pneumoniae strain BAK085

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag QJS47_RS20170 Protein ID WP_002892050.1
Coordinates 4068761..4068979 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag QJS47_RS20165 Protein ID WP_002892066.1
Coordinates 4068360..4068734 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJS47_RS20155 (QJS47_20155) 4063512..4064705 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
QJS47_RS20160 (QJS47_20160) 4064728..4067874 + 3147 WP_020326861.1 multidrug efflux RND transporter permease subunit AcrB -
QJS47_RS20165 (QJS47_20165) 4068360..4068734 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
QJS47_RS20170 (QJS47_20170) 4068761..4068979 + 219 WP_002892050.1 HHA domain-containing protein Toxin
QJS47_RS20175 (QJS47_20175) 4069138..4069704 + 567 WP_002892030.1 maltose O-acetyltransferase -
QJS47_RS20180 (QJS47_20180) 4069676..4069816 - 141 WP_004147370.1 hypothetical protein -
QJS47_RS20185 (QJS47_20185) 4069837..4070307 + 471 WP_002892026.1 YlaC family protein -
QJS47_RS20190 (QJS47_20190) 4070282..4071733 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
QJS47_RS20195 (QJS47_20195) 4071834..4072532 + 699 WP_002892021.1 GNAT family protein -
QJS47_RS20200 (QJS47_20200) 4072529..4072669 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
QJS47_RS20205 (QJS47_20205) 4072669..4072932 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T281907 WP_002892050.1 NZ_CP125088:4068761-4068979 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT281907 WP_002892066.1 NZ_CP125088:4068360-4068734 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References