Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 5096501..5097158 | Replicon | chromosome |
| Accession | NZ_CP125086 | ||
| Organism | Klebsiella pneumoniae subsp. pneumoniae strain HVKP2 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | W8UCT0 |
| Locus tag | QFB74_RS25765 | Protein ID | WP_002916310.1 |
| Coordinates | 5096748..5097158 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | W8UQ37 |
| Locus tag | QFB74_RS25760 | Protein ID | WP_002916312.1 |
| Coordinates | 5096501..5096767 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QFB74_RS25735 (5091709) | 5091709..5093142 | - | 1434 | WP_002916322.1 | 6-phospho-beta-glucosidase BglA | - |
| QFB74_RS25740 (5093261) | 5093261..5093989 | - | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
| QFB74_RS25745 (5094039) | 5094039..5094350 | + | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
| QFB74_RS25750 (5094514) | 5094514..5095173 | + | 660 | WP_002916317.1 | hemolysin III family protein | - |
| QFB74_RS25755 (5095272) | 5095272..5096255 | - | 984 | WP_014906951.1 | tRNA-modifying protein YgfZ | - |
| QFB74_RS25760 (5096501) | 5096501..5096767 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
| QFB74_RS25765 (5096748) | 5096748..5097158 | + | 411 | WP_002916310.1 | protein YgfX | Toxin |
| QFB74_RS25770 (5097165) | 5097165..5097686 | - | 522 | WP_002916308.1 | flavodoxin FldB | - |
| QFB74_RS25775 (5097787) | 5097787..5098683 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
| QFB74_RS25780 (5098706) | 5098706..5099419 | + | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| QFB74_RS25785 (5099425) | 5099425..5101158 | + | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T281898 WP_002916310.1 NZ_CP125086:5096748-5097158 [Klebsiella pneumoniae subsp. pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GSW7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GY41 |