Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 4220870..4221495 | Replicon | chromosome |
Accession | NZ_CP125086 | ||
Organism | Klebsiella pneumoniae subsp. pneumoniae strain HVKP2 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A330XB05 |
Locus tag | QFB74_RS21445 | Protein ID | WP_012737091.1 |
Coordinates | 4220870..4221253 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | J2DFR0 |
Locus tag | QFB74_RS21450 | Protein ID | WP_004150355.1 |
Coordinates | 4221253..4221495 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QFB74_RS21430 (4218236) | 4218236..4219138 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
QFB74_RS21435 (4219135) | 4219135..4219770 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
QFB74_RS21440 (4219767) | 4219767..4220696 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
QFB74_RS21445 (4220870) | 4220870..4221253 | - | 384 | WP_012737091.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QFB74_RS21450 (4221253) | 4221253..4221495 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
QFB74_RS21455 (4221700) | 4221700..4222617 | + | 918 | WP_012737090.1 | alpha/beta hydrolase | - |
QFB74_RS21460 (4222631) | 4222631..4223572 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
QFB74_RS21465 (4223617) | 4223617..4224054 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
QFB74_RS21470 (4224051) | 4224051..4224911 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
QFB74_RS21475 (4224905) | 4224905..4225504 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14266.53 Da Isoelectric Point: 7.2771
>T281895 WP_012737091.1 NZ_CP125086:c4221253-4220870 [Klebsiella pneumoniae subsp. pneumoniae]
MTSGSALFDTNILIDLFSGRCEAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKGFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRCEAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKGFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A330XB05 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GGU9 |