Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 3751196..3751712 | Replicon | chromosome |
| Accession | NZ_CP125086 | ||
| Organism | Klebsiella pneumoniae subsp. pneumoniae strain HVKP2 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | R4YAY3 |
| Locus tag | QFB74_RS19205 | Protein ID | WP_004178374.1 |
| Coordinates | 3751196..3751480 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | QFB74_RS19210 | Protein ID | WP_002886901.1 |
| Coordinates | 3751470..3751712 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QFB74_RS19180 (3746592) | 3746592..3746900 | - | 309 | WP_012737232.1 | PTS sugar transporter subunit IIB | - |
| QFB74_RS19185 (3746985) | 3746985..3747158 | + | 174 | WP_041169004.1 | hypothetical protein | - |
| QFB74_RS19190 (3747161) | 3747161..3747904 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| QFB74_RS19195 (3748261) | 3748261..3750399 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| QFB74_RS19200 (3750728) | 3750728..3751192 | + | 465 | WP_004222151.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| QFB74_RS19205 (3751196) | 3751196..3751480 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QFB74_RS19210 (3751470) | 3751470..3751712 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| QFB74_RS19215 (3751790) | 3751790..3753700 | - | 1911 | WP_012737231.1 | PRD domain-containing protein | - |
| QFB74_RS19220 (3753723) | 3753723..3754877 | - | 1155 | WP_012737230.1 | lactonase family protein | - |
| QFB74_RS19225 (3754944) | 3754944..3755684 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T281894 WP_004178374.1 NZ_CP125086:c3751480-3751196 [Klebsiella pneumoniae subsp. pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A6THG1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GLP0 |