Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 2995843..2996462 Replicon chromosome
Accession NZ_CP125086
Organism Klebsiella pneumoniae subsp. pneumoniae strain HVKP2

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag QFB74_RS15640 Protein ID WP_002892050.1
Coordinates 2996244..2996462 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag QFB74_RS15635 Protein ID WP_002892066.1
Coordinates 2995843..2996217 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QFB74_RS15625 (2990995) 2990995..2992188 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
QFB74_RS15630 (2992211) 2992211..2995357 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
QFB74_RS15635 (2995843) 2995843..2996217 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
QFB74_RS15640 (2996244) 2996244..2996462 + 219 WP_002892050.1 HHA domain-containing protein Toxin
QFB74_RS15645 (2996621) 2996621..2997187 + 567 WP_002892030.1 maltose O-acetyltransferase -
QFB74_RS15650 (2997159) 2997159..2997299 - 141 WP_004147370.1 hypothetical protein -
QFB74_RS15655 (2997320) 2997320..2997790 + 471 WP_002892026.1 YlaC family protein -
QFB74_RS15660 (2997765) 2997765..2999216 - 1452 WP_014907971.1 PLP-dependent aminotransferase family protein -
QFB74_RS15665 (2999317) 2999317..3000015 + 699 WP_002892021.1 GNAT family protein -
QFB74_RS15670 (3000012) 3000012..3000152 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
QFB74_RS15675 (3000152) 3000152..3000415 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T281892 WP_002892050.1 NZ_CP125086:2996244-2996462 [Klebsiella pneumoniae subsp. pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT281892 WP_002892066.1 NZ_CP125086:2995843-2996217 [Klebsiella pneumoniae subsp. pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References