Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 143603..144273 Replicon plasmid unnamed
Accession NZ_CP125085
Organism Klebsiella pneumoniae subsp. pneumoniae strain HVKP2

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag QFB74_RS00795 Protein ID WP_004213072.1
Coordinates 143603..144046 (-) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag QFB74_RS00800 Protein ID WP_004213073.1
Coordinates 144043..144273 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QFB74_RS00760 139012..139287 + 276 WP_004213932.1 carboxymuconolactone decarboxylase family protein -
QFB74_RS00765 139350..139841 + 492 WP_011251327.1 DM13 domain-containing protein -
QFB74_RS00770 139890..140810 + 921 WP_004213934.1 DUF1471 domain-containing protein -
QFB74_RS00775 140901..141304 + 404 Protein_154 GAF domain-containing protein -
QFB74_RS00780 141822..142459 - 638 Protein_155 mucoid phenotype regulator RmpA2 -
QFB74_RS00785 142876..143180 + 305 Protein_156 transposase -
QFB74_RS00790 143203..143454 - 252 WP_186987481.1 hypothetical protein -
QFB74_RS00795 143603..144046 - 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
QFB74_RS00800 144043..144273 - 231 WP_004213073.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QFB74_RS00805 144881..146014 + 1134 WP_004213075.1 DUF3800 domain-containing protein -
QFB74_RS00810 146030..146323 + 294 WP_004213076.1 hypothetical protein -
QFB74_RS00815 146313..146519 - 207 WP_004213077.1 hypothetical protein -
QFB74_RS00820 146871..147161 + 291 WP_004213078.1 hypothetical protein -
QFB74_RS00825 147151..148050 + 900 WP_004225022.1 nucleotide-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - iroB / iroC / iroD / iroN / rmpA / iucA / iucB / iucC / iucD / iutA / rmpA 1..223890 223890


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T281886 WP_004213072.1 NZ_CP125085:c144046-143603 [Klebsiella pneumoniae subsp. pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT281886 WP_004213073.1 NZ_CP125085:c144273-144043 [Klebsiella pneumoniae subsp. pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References