Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /RES-TIGR02293
Location 90957..91867 Replicon plasmid unnamed
Accession NZ_CP125085
Organism Klebsiella pneumoniae subsp. pneumoniae strain HVKP2

Toxin (Protein)


Gene name - Uniprot ID A0A663AYG0
Locus tag QFB74_RS00495 Protein ID WP_004026354.1
Coordinates 90957..91427 (-) Length 157 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A6P1V3Q9
Locus tag QFB74_RS00500 Protein ID WP_004026357.1
Coordinates 91424..91867 (-) Length 148 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QFB74_RS00470 86369..86767 - 399 WP_004212796.1 H-NS family nucleoid-associated regulatory protein -
QFB74_RS00475 87104..87598 - 495 WP_004212794.1 thermonuclease family protein -
QFB74_RS00480 87776..88042 + 267 WP_223175074.1 DUF1173 family protein -
QFB74_RS00485 88075..88725 + 651 WP_068893702.1 DUF1173 family protein -
QFB74_RS00495 90957..91427 - 471 WP_004026354.1 RES family NAD+ phosphorylase Toxin
QFB74_RS00500 91424..91867 - 444 WP_004026357.1 DUF2384 domain-containing protein Antitoxin
QFB74_RS00505 91968..92471 - 504 Protein_100 DUF4113 domain-containing protein -
QFB74_RS00510 92569..92790 - 222 WP_004213643.1 DUF2188 domain-containing protein -
QFB74_RS00515 92965..93090 - 126 Protein_102 Fe3+-citrate ABC transporter substrate-binding protein -
QFB74_RS00520 93165..95291 - 2127 WP_004213640.1 TonB-dependent Fe(3+) dicitrate receptor FecA -
QFB74_RS00525 95378..96331 - 954 Protein_104 ferric citrate uptake sigma factor regulator FecR -
QFB74_RS00530 96328..96849 - 522 WP_004213635.1 ferric citrate uptake sigma factor FecI -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - iroB / iroC / iroD / iroN / rmpA / iucA / iucB / iucC / iucD / iutA / rmpA 1..223890 223890
- flank IS/Tn - - 90111..90614 503


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

RES domain

(3-148)

Antitoxin

Antitoxin Xre-like, helix-turn-helix domain

(30-89)


Sequences

Toxin        


Download         Length: 157 a.a.        Molecular weight: 17515.79 Da        Isoelectric Point: 4.6155

>T281885 WP_004026354.1 NZ_CP125085:c91427-90957 [Klebsiella pneumoniae subsp. pneumoniae]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK

Download         Length: 471 bp

Antitoxin


Download         Length: 148 a.a.        Molecular weight: 16480.80 Da        Isoelectric Point: 10.2498

>AT281885 WP_004026357.1 NZ_CP125085:c91867-91424 [Klebsiella pneumoniae subsp. pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS

Download         Length: 444 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A663AYG0

Antitoxin

Source ID Structure
AlphaFold DB A0A6P1V3Q9

References