Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 67199..67734 | Replicon | plasmid p_IncFIA_HI1 |
| Accession | NZ_CP125084 | ||
| Organism | Klebsiella pneumoniae subsp. pneumoniae strain HVKP1 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | QFB57_RS26660 | Protein ID | WP_016531292.1 |
| Coordinates | 67199..67486 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | W9BAK2 |
| Locus tag | QFB57_RS26665 | Protein ID | WP_016531291.1 |
| Coordinates | 67483..67734 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QFB57_RS26640 | 62998..64218 | - | 1221 | WP_032446666.1 | ISL3-like element ISKox3 family transposase | - |
| QFB57_RS26645 | 64379..64855 | + | 477 | WP_016529487.1 | hypothetical protein | - |
| QFB57_RS26650 | 65112..65399 | - | 288 | WP_016529486.1 | hypothetical protein | - |
| QFB57_RS26655 | 65489..66151 | - | 663 | WP_016529485.1 | division plane positioning ATPase MipZ | - |
| QFB57_RS26660 | 67199..67486 | - | 288 | WP_016531292.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QFB57_RS26665 | 67483..67734 | - | 252 | WP_016531291.1 | toxin-antitoxin stability system antitoxin protein StbD | Antitoxin |
| QFB57_RS26670 | 67830..69101 | - | 1272 | WP_046041953.1 | Y-family DNA polymerase | - |
| QFB57_RS26675 | 69101..69595 | - | 495 | WP_109234271.1 | translesion error-prone DNA polymerase V autoproteolytic subunit | - |
| QFB57_RS26680 | 69581..70660 | + | 1080 | WP_016531016.1 | IS481 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | clbI / basG | 1..95433 | 95433 | |
| - | flank | IS/Tn | - | - | 62998..64218 | 1220 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11120.16 Da Isoelectric Point: 10.4373
>T281883 WP_016531292.1 NZ_CP125084:c67486-67199 [Klebsiella pneumoniae subsp. pneumoniae]
MTYTVKFREDALKEWNKLDKTIQQQFAKKLKKCCENPHIPSAKLRGIKDCYKIKLRASGFRLVYQVIDNQLIIAIVAVGK
RERSDVYTLASERMK
MTYTVKFREDALKEWNKLDKTIQQQFAKKLKKCCENPHIPSAKLRGIKDCYKIKLRASGFRLVYQVIDNQLIIAIVAVGK
RERSDVYTLASERMK
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|