Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 51209..51852 | Replicon | plasmid p_IncFIA_HI1 |
Accession | NZ_CP125084 | ||
Organism | Klebsiella pneumoniae subsp. pneumoniae strain HVKP1 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | B1LRW4 |
Locus tag | QFB57_RS26580 | Protein ID | WP_001044768.1 |
Coordinates | 51209..51625 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D2WFK3 |
Locus tag | QFB57_RS26585 | Protein ID | WP_001261287.1 |
Coordinates | 51622..51852 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QFB57_RS26545 | 46303..46557 | - | 255 | WP_016528790.1 | hypothetical protein | - |
QFB57_RS26550 | 46633..46890 | - | 258 | WP_004098928.1 | hypothetical protein | - |
QFB57_RS26555 | 46939..47142 | - | 204 | WP_004150739.1 | HHA domain-containing protein | - |
QFB57_RS26560 | 47203..47697 | - | 495 | WP_016528789.1 | hypothetical protein | - |
QFB57_RS26565 | 47728..48294 | - | 567 | WP_009654312.1 | hypothetical protein | - |
QFB57_RS26570 | 48291..48554 | - | 264 | WP_009310051.1 | hypothetical protein | - |
QFB57_RS26575 | 48909..51047 | + | 2139 | WP_000350635.1 | AAA family ATPase | - |
QFB57_RS26580 | 51209..51625 | - | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QFB57_RS26585 | 51622..51852 | - | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QFB57_RS26590 | 52158..55277 | + | 3120 | WP_032446663.1 | hypothetical protein | - |
QFB57_RS26595 | 55540..56673 | + | 1134 | WP_000545983.1 | DUF3800 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | clbI / basG | 1..95433 | 95433 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T281882 WP_001044768.1 NZ_CP125084:c51625-51209 [Klebsiella pneumoniae subsp. pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A606Q844 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QFC4 |