Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 4824755..4825412 | Replicon | chromosome |
Accession | NZ_CP125083 | ||
Organism | Klebsiella pneumoniae subsp. pneumoniae strain HVKP1 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | W8UCT0 |
Locus tag | QFB57_RS24160 | Protein ID | WP_002916310.1 |
Coordinates | 4825002..4825412 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | QFB57_RS24155 | Protein ID | WP_002916312.1 |
Coordinates | 4824755..4825021 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QFB57_RS24130 (4819911) | 4819911..4821344 | - | 1434 | WP_002916322.1 | 6-phospho-beta-glucosidase BglA | - |
QFB57_RS24135 (4821463) | 4821463..4822191 | - | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
QFB57_RS24140 (4822241) | 4822241..4822552 | + | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
QFB57_RS24145 (4822716) | 4822716..4823375 | + | 660 | WP_002916317.1 | hemolysin III family protein | - |
QFB57_RS24150 (4823526) | 4823526..4824509 | - | 984 | WP_023286864.1 | tRNA-modifying protein YgfZ | - |
QFB57_RS24155 (4824755) | 4824755..4825021 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
QFB57_RS24160 (4825002) | 4825002..4825412 | + | 411 | WP_002916310.1 | protein YgfX | Toxin |
QFB57_RS24165 (4825419) | 4825419..4825940 | - | 522 | WP_004144730.1 | flavodoxin FldB | - |
QFB57_RS24170 (4826041) | 4826041..4826937 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
QFB57_RS24175 (4826960) | 4826960..4827673 | + | 714 | WP_282822445.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
QFB57_RS24180 (4827679) | 4827679..4829412 | + | 1734 | WP_032445465.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T281881 WP_002916310.1 NZ_CP125083:4825002-4825412 [Klebsiella pneumoniae subsp. pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GSW7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GY41 |