Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 3484355..3484871 | Replicon | chromosome |
| Accession | NZ_CP125083 | ||
| Organism | Klebsiella pneumoniae subsp. pneumoniae strain HVKP1 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | QFB57_RS17585 | Protein ID | WP_032446557.1 |
| Coordinates | 3484355..3484639 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | QFB57_RS17590 | Protein ID | WP_002886901.1 |
| Coordinates | 3484629..3484871 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QFB57_RS17560 (3479751) | 3479751..3480059 | - | 309 | WP_002886907.1 | PTS sugar transporter subunit IIB | - |
| QFB57_RS17565 (3480144) | 3480144..3480317 | + | 174 | WP_002886906.1 | hypothetical protein | - |
| QFB57_RS17570 (3480320) | 3480320..3481063 | + | 744 | WP_032446555.1 | MurR/RpiR family transcriptional regulator | - |
| QFB57_RS17575 (3481420) | 3481420..3483558 | + | 2139 | WP_032446556.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| QFB57_RS17580 (3483887) | 3483887..3484351 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| QFB57_RS17585 (3484355) | 3484355..3484639 | - | 285 | WP_032446557.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QFB57_RS17590 (3484629) | 3484629..3484871 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| QFB57_RS17595 (3484949) | 3484949..3486859 | - | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
| QFB57_RS17600 (3486882) | 3486882..3488036 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
| QFB57_RS17605 (3488103) | 3488103..3488843 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11110.98 Da Isoelectric Point: 10.3787
>T281875 WP_032446557.1 NZ_CP125083:c3484639-3484355 [Klebsiella pneumoniae subsp. pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHLANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHLANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|