Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
| Location | 3383215..3383918 | Replicon | chromosome |
| Accession | NZ_CP125083 | ||
| Organism | Klebsiella pneumoniae subsp. pneumoniae strain HVKP1 | ||
Toxin (Protein)
| Gene name | ypjF | Uniprot ID | - |
| Locus tag | QFB57_RS17220 | Protein ID | WP_049017155.1 |
| Coordinates | 3383215..3383556 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | - |
| Locus tag | QFB57_RS17225 | Protein ID | WP_049243960.1 |
| Coordinates | 3383577..3383918 (-) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QFB57_RS17195 (3379791) | 3379791..3380918 | + | 1128 | WP_023325431.1 | PAAR domain-containing protein | - |
| QFB57_RS17200 (3380938) | 3380938..3381171 | + | 234 | WP_014908049.1 | hypothetical protein | - |
| QFB57_RS17205 (3381317) | 3381317..3381451 | + | 135 | Protein_3170 | transposase | - |
| QFB57_RS17210 (3381464) | 3381464..3381574 | - | 111 | Protein_3171 | DUF4102 domain-containing protein | - |
| QFB57_RS17215 (3381949) | 3381949..3382956 | - | 1008 | WP_049017154.1 | restriction endonuclease | - |
| QFB57_RS17220 (3383215) | 3383215..3383556 | - | 342 | WP_049017155.1 | TA system toxin CbtA family protein | Toxin |
| QFB57_RS17225 (3383577) | 3383577..3383918 | - | 342 | WP_049243960.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QFB57_RS17230 (3383929) | 3383929..3384471 | - | 543 | WP_049017157.1 | DNA repair protein RadC | - |
| QFB57_RS17235 (3384484) | 3384484..3384927 | - | 444 | WP_047365977.1 | antirestriction protein | - |
| QFB57_RS17240 (3384958) | 3384958..3385779 | - | 822 | WP_049017158.1 | DUF932 domain-containing protein | - |
| QFB57_RS17245 (3385900) | 3385900..3386373 | - | 474 | WP_049017159.1 | hypothetical protein | - |
| QFB57_RS17250 (3386445) | 3386445..3386897 | - | 453 | WP_077258843.1 | hypothetical protein | - |
| QFB57_RS17255 (3386933) | 3386933..3387649 | - | 717 | WP_048291793.1 | WYL domain-containing protein | - |
| QFB57_RS17260 (3387893) | 3387893..3388768 | - | 876 | WP_048291792.1 | GTPase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3374757..3400171 | 25414 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12724.66 Da Isoelectric Point: 6.4514
>T281874 WP_049017155.1 NZ_CP125083:c3383556-3383215 [Klebsiella pneumoniae subsp. pneumoniae]
MKTLPATTPQAATLCLSPVAVWQMLLACLLEQHYGLTLNDTPFSDETVIQEHIDAGITLADAVNFLVEKYELVRIDRRGF
NWQEQSPYLRAVDILRARQATGLLKRNRISAAQ
MKTLPATTPQAATLCLSPVAVWQMLLACLLEQHYGLTLNDTPFSDETVIQEHIDAGITLADAVNFLVEKYELVRIDRRGF
NWQEQSPYLRAVDILRARQATGLLKRNRISAAQ
Download Length: 342 bp
Antitoxin
Download Length: 114 a.a. Molecular weight: 12840.57 Da Isoelectric Point: 6.7344
>AT281874 WP_049243960.1 NZ_CP125083:c3383918-3383577 [Klebsiella pneumoniae subsp. pneumoniae]
MKYTDSENDSFLKWGLNRNVTPCFVARLVQEGNRLHYLADRASITGKFSEAECLKLDVAFPHFISQMESMLTTGEMNPRH
AHCVTLYHNGFTCEADTLGSCGYVYIAVYPTHR
MKYTDSENDSFLKWGLNRNVTPCFVARLVQEGNRLHYLADRASITGKFSEAECLKLDVAFPHFISQMESMLTTGEMNPRH
AHCVTLYHNGFTCEADTLGSCGYVYIAVYPTHR
Download Length: 342 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|