Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
Location | 3347915..3348725 | Replicon | chromosome |
Accession | NZ_CP125083 | ||
Organism | Klebsiella pneumoniae subsp. pneumoniae strain HVKP1 |
Toxin (Protein)
Gene name | KacT | Uniprot ID | A0A060VJ83 |
Locus tag | QFB57_RS17050 | Protein ID | WP_004178461.1 |
Coordinates | 3347915..3348448 (-) | Length | 178 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | J2E9Q7 |
Locus tag | QFB57_RS17055 | Protein ID | WP_002887278.1 |
Coordinates | 3348459..3348725 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QFB57_RS17045 (3346746) | 3346746..3347867 | + | 1122 | WP_009309849.1 | cupin domain-containing protein | - |
QFB57_RS17050 (3347915) | 3347915..3348448 | - | 534 | WP_004178461.1 | type II toxin-antitoxin system toxin KacT | Toxin |
QFB57_RS17055 (3348459) | 3348459..3348725 | - | 267 | WP_002887278.1 | type II toxin-antitoxin system antitoxin KacA | Antitoxin |
QFB57_RS17060 (3348828) | 3348828..3350261 | - | 1434 | WP_032446518.1 | Cu(+)/Ag(+) sensor histidine kinase | - |
QFB57_RS17065 (3350251) | 3350251..3350934 | - | 684 | WP_002887273.1 | copper response regulator transcription factor CusR | - |
QFB57_RS17070 (3351106) | 3351106..3352488 | + | 1383 | WP_032446519.1 | efflux transporter outer membrane subunit | - |
QFB57_RS17075 (3352506) | 3352506..3352850 | + | 345 | WP_025987660.1 | cation efflux system protein CusF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 19810.65 Da Isoelectric Point: 5.2614
>T281873 WP_004178461.1 NZ_CP125083:c3348448-3347915 [Klebsiella pneumoniae subsp. pneumoniae]
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
Download Length: 534 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A060VJ83 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 5ZGN | |
AlphaFold DB | A0A0H3GLZ1 |