Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 2723883..2724502 Replicon chromosome
Accession NZ_CP125083
Organism Klebsiella pneumoniae subsp. pneumoniae strain HVKP1

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag QFB57_RS14095 Protein ID WP_002892050.1
Coordinates 2724284..2724502 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag QFB57_RS14090 Protein ID WP_002892066.1
Coordinates 2723883..2724257 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QFB57_RS14080 (2719035) 2719035..2720228 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
QFB57_RS14085 (2720251) 2720251..2723397 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
QFB57_RS14090 (2723883) 2723883..2724257 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
QFB57_RS14095 (2724284) 2724284..2724502 + 219 WP_002892050.1 HHA domain-containing protein Toxin
QFB57_RS14100 (2724661) 2724661..2725227 + 567 WP_002892030.1 maltose O-acetyltransferase -
QFB57_RS14105 (2725199) 2725199..2725339 - 141 WP_004147370.1 hypothetical protein -
QFB57_RS14110 (2725360) 2725360..2725830 + 471 WP_002892026.1 YlaC family protein -
QFB57_RS14115 (2725805) 2725805..2727256 - 1452 WP_032445639.1 PLP-dependent aminotransferase family protein -
QFB57_RS14120 (2727357) 2727357..2728055 + 699 WP_002892021.1 GNAT family protein -
QFB57_RS14125 (2728052) 2728052..2728192 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
QFB57_RS14130 (2728192) 2728192..2728455 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T281872 WP_002892050.1 NZ_CP125083:2724284-2724502 [Klebsiella pneumoniae subsp. pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT281872 WP_002892066.1 NZ_CP125083:2723883-2724257 [Klebsiella pneumoniae subsp. pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References