Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 2723883..2724502 | Replicon | chromosome |
Accession | NZ_CP125083 | ||
Organism | Klebsiella pneumoniae subsp. pneumoniae strain HVKP1 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | QFB57_RS14095 | Protein ID | WP_002892050.1 |
Coordinates | 2724284..2724502 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | J2DPF6 |
Locus tag | QFB57_RS14090 | Protein ID | WP_002892066.1 |
Coordinates | 2723883..2724257 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QFB57_RS14080 (2719035) | 2719035..2720228 | + | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
QFB57_RS14085 (2720251) | 2720251..2723397 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
QFB57_RS14090 (2723883) | 2723883..2724257 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
QFB57_RS14095 (2724284) | 2724284..2724502 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
QFB57_RS14100 (2724661) | 2724661..2725227 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
QFB57_RS14105 (2725199) | 2725199..2725339 | - | 141 | WP_004147370.1 | hypothetical protein | - |
QFB57_RS14110 (2725360) | 2725360..2725830 | + | 471 | WP_002892026.1 | YlaC family protein | - |
QFB57_RS14115 (2725805) | 2725805..2727256 | - | 1452 | WP_032445639.1 | PLP-dependent aminotransferase family protein | - |
QFB57_RS14120 (2727357) | 2727357..2728055 | + | 699 | WP_002892021.1 | GNAT family protein | - |
QFB57_RS14125 (2728052) | 2728052..2728192 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
QFB57_RS14130 (2728192) | 2728192..2728455 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T281872 WP_002892050.1 NZ_CP125083:2724284-2724502 [Klebsiella pneumoniae subsp. pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT281872 WP_002892066.1 NZ_CP125083:2723883-2724257 [Klebsiella pneumoniae subsp. pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GJ93 |