Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 139444..140195 | Replicon | plasmid p_IncFIB_K |
Accession | NZ_CP125081 | ||
Organism | Klebsiella pneumoniae subsp. pneumoniae strain HVKP1 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | W9BA31 |
Locus tag | QFB57_RS00755 | Protein ID | WP_032104592.1 |
Coordinates | 139444..139926 (-) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | W9B1S8 |
Locus tag | QFB57_RS00760 | Protein ID | WP_016529519.1 |
Coordinates | 139917..140195 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QFB57_RS00725 | 135027..135479 | + | 453 | WP_020948374.1 | transcriptional repressor | - |
QFB57_RS00730 | 135627..136855 | + | 1229 | WP_085956323.1 | IS3 family transposase | - |
QFB57_RS00735 | 137240..137476 | + | 237 | WP_016529523.1 | hypothetical protein | - |
QFB57_RS00740 | 137571..137732 | - | 162 | WP_223367960.1 | bacteriocin immunity protein | - |
QFB57_RS00745 | 137832..138665 | - | 834 | WP_012540133.1 | GIY-YIG nuclease family protein | - |
QFB57_RS00750 | 139002..139406 | - | 405 | WP_016529521.1 | DUF2251 domain-containing protein | - |
QFB57_RS00755 | 139444..139926 | - | 483 | WP_032104592.1 | GNAT family N-acetyltransferase | Toxin |
QFB57_RS00760 | 139917..140195 | - | 279 | WP_016529519.1 | DUF1778 domain-containing protein | Antitoxin |
QFB57_RS00765 | 140503..141039 | + | 537 | WP_032445791.1 | hypothetical protein | - |
QFB57_RS00770 | 141423..142433 | - | 1011 | WP_004152284.1 | zinc-binding alcohol dehydrogenase family protein | - |
QFB57_RS00775 | 142776..142858 | + | 83 | Protein_154 | hypothetical protein | - |
QFB57_RS00780 | 142894..143976 | + | 1083 | WP_016528990.1 | DNA-binding transcriptional repressor LacI | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | rmpA / iroN / iroD / iroC / iroB / iutA / iucD / iucC / iucB / iucA | 1..154088 | 154088 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17781.73 Da Isoelectric Point: 9.4946
>T281865 WP_032104592.1 NZ_CP125081:c139926-139444 [Klebsiella pneumoniae subsp. pneumoniae]
MGMRPPEPLTPEHNIAEFCCQDQVLSEWLKKKALKNHRTGISRVFVVCAENTNRVIAYYCLASGSVHRNTVPGAYRRNAP
EALPVIVLGRLAVDAAWARKGLGAALLKDAIYRTEHIAIQVGVRALLVHALNDEVREFYTKFGFEPSIANALTLLFPIKT
MGMRPPEPLTPEHNIAEFCCQDQVLSEWLKKKALKNHRTGISRVFVVCAENTNRVIAYYCLASGSVHRNTVPGAYRRNAP
EALPVIVLGRLAVDAAWARKGLGAALLKDAIYRTEHIAIQVGVRALLVHALNDEVREFYTKFGFEPSIANALTLLFPIKT
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|