Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 2109301..2109907 | Replicon | chromosome |
Accession | NZ_CP124967 | ||
Organism | Agrobacterium tumefaciens strain O54/95 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | A0A822UZY8 |
Locus tag | G6L90_RS10490 | Protein ID | WP_020011654.1 |
Coordinates | 2109301..2109597 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | A0A822V132 |
Locus tag | G6L90_RS10495 | Protein ID | WP_060723677.1 |
Coordinates | 2109602..2109907 (+) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
G6L90_RS10455 (G6L90_10455) | 2104897..2105244 | + | 348 | WP_004429958.1 | antibiotic biosynthesis monooxygenase | - |
G6L90_RS10460 (G6L90_10460) | 2105254..2105778 | + | 525 | WP_112278475.1 | heme utilization cystosolic carrier protein HutX | - |
G6L90_RS10465 (G6L90_10465) | 2105962..2106351 | + | 390 | WP_223564872.1 | hypothetical protein | - |
G6L90_RS10470 (G6L90_10470) | 2106503..2107042 | + | 540 | WP_111792962.1 | DUF2975 domain-containing protein | - |
G6L90_RS10475 (G6L90_10475) | 2107052..2107294 | + | 243 | WP_080866411.1 | helix-turn-helix transcriptional regulator | - |
G6L90_RS10480 (G6L90_10480) | 2107388..2108164 | + | 777 | WP_020809374.1 | YbaY family lipoprotein | - |
G6L90_RS10485 (G6L90_10485) | 2108371..2109255 | + | 885 | WP_004429922.1 | formyltetrahydrofolate deformylase | - |
G6L90_RS10490 (G6L90_10490) | 2109301..2109597 | + | 297 | WP_020011654.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
G6L90_RS10495 (G6L90_10495) | 2109602..2109907 | + | 306 | WP_060723677.1 | putative addiction module antidote protein | Antitoxin |
G6L90_RS10500 (G6L90_10500) | 2109921..2111315 | - | 1395 | WP_129565097.1 | sensor histidine kinase | - |
G6L90_RS10505 (G6L90_10505) | 2111312..2111992 | - | 681 | WP_003491888.1 | response regulator transcription factor | - |
G6L90_RS10510 (G6L90_10510) | 2112073..2113140 | + | 1068 | WP_223566790.1 | ABC transporter substrate-binding protein | - |
G6L90_RS10515 (G6L90_10515) | 2113586..2114530 | + | 945 | WP_174069831.1 | tripartite tricarboxylate transporter substrate binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 10888.61 Da Isoelectric Point: 10.2733
>T281860 WP_020011654.1 NZ_CP124967:2109301-2109597 [Agrobacterium tumefaciens]
MLTIRETSEFADWLAGLRDVQARARIARRIYRLADGNPGDVKPVGEGVSELRIDLGPGYRVYFVRHGDVVIILLCGGDKA
SQPRDIARAKKLARALKE
MLTIRETSEFADWLAGLRDVQARARIARRIYRLADGNPGDVKPVGEGVSELRIDLGPGYRVYFVRHGDVVIILLCGGDKA
SQPRDIARAKKLARALKE
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A822UZY8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A822V132 |