Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-RelB |
Location | 570515..571122 | Replicon | chromosome |
Accession | NZ_CP124967 | ||
Organism | Agrobacterium tumefaciens strain O54/95 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | G6L90_RS02825 | Protein ID | WP_020811443.1 |
Coordinates | 570515..570802 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A822V573 |
Locus tag | G6L90_RS02830 | Protein ID | WP_020811442.1 |
Coordinates | 570847..571122 (-) | Length | 92 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
G6L90_RS02810 (G6L90_02810) | 566568..568760 | - | 2193 | WP_003509229.1 | transglycosylase domain-containing protein | - |
G6L90_RS02815 (G6L90_02815) | 569015..569494 | + | 480 | WP_003509227.1 | YcgN family cysteine cluster protein | - |
G6L90_RS02820 (G6L90_02820) | 569663..570487 | + | 825 | WP_003509224.1 | class D beta-lactamase | - |
G6L90_RS02825 (G6L90_02825) | 570515..570802 | - | 288 | WP_020811443.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
G6L90_RS02830 (G6L90_02830) | 570847..571122 | - | 276 | WP_020811442.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
G6L90_RS02835 (G6L90_02835) | 571336..573915 | + | 2580 | WP_174069514.1 | heavy metal translocating P-type ATPase | - |
G6L90_RS02840 (G6L90_02840) | 573912..574334 | + | 423 | WP_003509219.1 | Cu(I)-responsive transcriptional regulator | - |
G6L90_RS02845 (G6L90_02845) | 574387..574587 | + | 201 | WP_060723954.1 | heavy-metal-associated domain-containing protein | - |
G6L90_RS02850 (G6L90_02850) | 574664..574933 | + | 270 | WP_003509217.1 | type II toxin-antitoxin system ParD family antitoxin | - |
G6L90_RS02855 (G6L90_02855) | 574923..575288 | + | 366 | WP_060726102.1 | hypothetical protein | - |
G6L90_RS02860 (G6L90_02860) | 575285..575533 | - | 249 | WP_162690375.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11264.90 Da Isoelectric Point: 6.9783
>T281859 WP_020811443.1 NZ_CP124967:c570802-570515 [Agrobacterium tumefaciens]
VLPRSSDFTRQFIKDWQRLNNSGRYDMVKLKEIMLLLIANEAPLPAQFRDHELTGEWHDHRECHVGGDFLLIYKLDEKQN
LLIFTRAGTHAELFR
VLPRSSDFTRQFIKDWQRLNNSGRYDMVKLKEIMLLLIANEAPLPAQFRDHELTGEWHDHRECHVGGDFLLIYKLDEKQN
LLIFTRAGTHAELFR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|