Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | parDE/CC2985(antitoxin) |
Location | 442037..442581 | Replicon | chromosome |
Accession | NZ_CP124967 | ||
Organism | Agrobacterium tumefaciens strain O54/95 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | G6L90_RS02140 | Protein ID | WP_173992172.1 |
Coordinates | 442291..442581 (+) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A822V4A8 |
Locus tag | G6L90_RS02135 | Protein ID | WP_003509084.1 |
Coordinates | 442037..442288 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
G6L90_RS02115 (G6L90_02115) | 437800..438480 | + | 681 | WP_003509096.1 | GntR family transcriptional regulator | - |
G6L90_RS02120 (G6L90_02120) | 438526..439002 | + | 477 | WP_107675263.1 | DUF1284 domain-containing protein | - |
G6L90_RS02125 (G6L90_02125) | 439177..440277 | - | 1101 | WP_087743497.1 | hypothetical protein | - |
G6L90_RS02130 (G6L90_02130) | 440514..441659 | + | 1146 | WP_020010628.1 | site-specific DNA-methyltransferase | - |
G6L90_RS02135 (G6L90_02135) | 442037..442288 | + | 252 | WP_003509084.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
G6L90_RS02140 (G6L90_02140) | 442291..442581 | + | 291 | WP_173992172.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
G6L90_RS02145 (G6L90_02145) | 442623..443234 | - | 612 | WP_087743505.1 | HAD family phosphatase | - |
G6L90_RS02150 (G6L90_02150) | 443231..444343 | - | 1113 | WP_099085591.1 | A/G-specific adenine glycosylase | - |
G6L90_RS02155 (G6L90_02155) | 444471..444935 | + | 465 | WP_020812858.1 | hypothetical protein | - |
G6L90_RS02160 (G6L90_02160) | 444963..445484 | + | 522 | WP_003509079.1 | DUF721 domain-containing protein | - |
G6L90_RS02165 (G6L90_02165) | 445613..446293 | + | 681 | WP_003509078.1 | DsbA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11225.88 Da Isoelectric Point: 6.2182
>T281858 WP_173992172.1 NZ_CP124967:442291-442581 [Agrobacterium tumefaciens]
VGFRLSLLAEEDVIRIAEEGIAIFGLAQAQKYHRELYEIFELISLNPRMARERHELLPPLRIHRFRTHLVVYGVGADDDV
LIVRVRHAHEDWVNES
VGFRLSLLAEEDVIRIAEEGIAIFGLAQAQKYHRELYEIFELISLNPRMARERHELLPPLRIHRFRTHLVVYGVGADDDV
LIVRVRHAHEDWVNES
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|