Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pasABC/RelE-HTH |
| Location | 321153..321639 | Replicon | chromosome |
| Accession | NZ_CP124967 | ||
| Organism | Agrobacterium tumefaciens strain O54/95 | ||
Toxin (Protein)
| Gene name | pasB | Uniprot ID | A0A846L580 |
| Locus tag | G6L90_RS01520 | Protein ID | WP_003503189.1 |
| Coordinates | 321153..321422 (-) | Length | 90 a.a. |
Antitoxin (Protein)
| Gene name | pasA | Uniprot ID | A0A822V377 |
| Locus tag | G6L90_RS01525 | Protein ID | WP_003503188.1 |
| Coordinates | 321406..321639 (-) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| G6L90_RS01485 (G6L90_01485) | 316175..316804 | + | 630 | WP_003503196.1 | DNA-3-methyladenine glycosylase I | - |
| G6L90_RS01490 (G6L90_01490) | 316801..317247 | + | 447 | WP_060726047.1 | hypothetical protein | - |
| G6L90_RS01495 (G6L90_01495) | 317263..318306 | - | 1044 | WP_065694890.1 | YeiH family protein | - |
| G6L90_RS01500 (G6L90_01500) | 318388..319305 | + | 918 | WP_026363679.1 | LysR substrate-binding domain-containing protein | - |
| G6L90_RS01505 (G6L90_01505) | 319516..319890 | - | 375 | WP_129564593.1 | DUF305 domain-containing protein | - |
| G6L90_RS01510 (G6L90_01510) | 319948..320340 | - | 393 | WP_003503191.1 | hypothetical protein | - |
| G6L90_RS01515 (G6L90_01515) | 320382..321146 | - | 765 | WP_003503190.1 | hypothetical protein | - |
| G6L90_RS01520 (G6L90_01520) | 321153..321422 | - | 270 | WP_003503189.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| G6L90_RS01525 (G6L90_01525) | 321406..321639 | - | 234 | WP_003503188.1 | DUF6290 family protein | Antitoxin |
| G6L90_RS01530 (G6L90_01530) | 321797..323320 | + | 1524 | WP_174069498.1 | histidine--tRNA ligase | - |
| G6L90_RS01535 (G6L90_01535) | 323325..323693 | + | 369 | WP_111833685.1 | VOC family protein | - |
| G6L90_RS01540 (G6L90_01540) | 323710..324837 | + | 1128 | WP_111781269.1 | ATP phosphoribosyltransferase regulatory subunit | - |
| G6L90_RS01545 (G6L90_01545) | 324834..325526 | + | 693 | WP_003503184.1 | ATP phosphoribosyltransferase | - |
| G6L90_RS01550 (G6L90_01550) | 325589..326035 | - | 447 | WP_003503183.1 | DoxX family protein | - |
| G6L90_RS01555 (G6L90_01555) | 326192..326626 | - | 435 | WP_003503182.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10341.95 Da Isoelectric Point: 10.6086
>T281857 WP_003503189.1 NZ_CP124967:c321422-321153 [Agrobacterium tumefaciens]
MIWKIEFQRAAVKQLGALTKSDANRIVSFLTDRIARDGNPRRTGAALQGSELGNFWRYRVGDYRIICDIQDHKLVVLVVE
IGHRREIYR
MIWKIEFQRAAVKQLGALTKSDANRIVSFLTDRIARDGNPRRTGAALQGSELGNFWRYRVGDYRIICDIQDHKLVVLVVE
IGHRREIYR
Download Length: 270 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A846L580 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A822V377 |