Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/CC2985(antitoxin) |
| Location | 112586..113133 | Replicon | plasmid pAtAF1_95 |
| Accession | NZ_CP124965 | ||
| Organism | Agrobacterium fabacearum strain AF1/95 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | G6L16_RS24200 | Protein ID | WP_174004674.1 |
| Coordinates | 112840..113133 (+) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A7U5CZ68 |
| Locus tag | G6L16_RS24195 | Protein ID | WP_003519100.1 |
| Coordinates | 112586..112840 (+) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| G6L16_RS24185 (G6L16_024185) | 108141..111254 | + | 3114 | WP_284180582.1 | efflux RND transporter permease subunit | - |
| G6L16_RS24190 (G6L16_024190) | 111462..112139 | - | 678 | WP_174004672.1 | SOS response-associated peptidase | - |
| G6L16_RS24195 (G6L16_024195) | 112586..112840 | + | 255 | WP_003519100.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
| G6L16_RS24200 (G6L16_024200) | 112840..113133 | + | 294 | WP_174004674.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| G6L16_RS24205 (G6L16_024205) | 113299..113928 | - | 630 | WP_174004676.1 | plasmid pRiA4b ORF-3 family protein | - |
| G6L16_RS24210 (G6L16_024210) | 114070..115422 | - | 1353 | WP_174004678.1 | cytosine deaminase | - |
| G6L16_RS24215 (G6L16_024215) | 115454..116425 | - | 972 | WP_174004680.1 | LysR family transcriptional regulator | - |
| G6L16_RS24220 (G6L16_024220) | 116428..117423 | - | 996 | WP_003517482.1 | 2-oxoglutarate and iron-dependent oxygenase domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..804464 | 804464 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11207.92 Da Isoelectric Point: 6.2160
>T281856 WP_174004674.1 NZ_CP124965:112840-113133 [Agrobacterium fabacearum]
MPFSLSVQAEEDIIFIAEEGIRIFGALVAKRYHDELFALLELIATNPRMARERHEISPPVRIHPFKAHLVVYRIIEDGSV
FVIRIRHGHEDWAGDSF
MPFSLSVQAEEDIIFIAEEGIRIFGALVAKRYHDELFALLELIATNPRMARERHEISPPVRIHPFKAHLVVYRIIEDGSV
FVIRIRHGHEDWAGDSF
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|