Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 4836..5467 Replicon plasmid pAtAF1_95
Accession NZ_CP124965
Organism Agrobacterium fabacearum strain AF1/95

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag G6L16_RS23720 Protein ID WP_038496209.1
Coordinates 4836..5237 (-) Length 134 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag G6L16_RS23725 Protein ID WP_174005169.1
Coordinates 5237..5467 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
G6L16_RS23695 (G6L16_023695) 1221..2246 + 1026 WP_038496201.1 plasmid partitioning protein RepB -
G6L16_RS23700 (G6L16_023700) 2449..3663 + 1215 WP_174005167.1 plasmid replication protein RepC -
G6L16_RS23705 (G6L16_023705) 3711..3876 - 166 Protein_3 type II toxin-antitoxin system RelE/ParE family toxin -
G6L16_RS23710 (G6L16_023710) 3873..4163 - 291 WP_174005168.1 type II toxin-antitoxin system RelB/DinJ family antitoxin -
G6L16_RS23715 (G6L16_023715) 4548..4760 + 213 WP_284180588.1 BrnA antitoxin family protein -
G6L16_RS23720 (G6L16_023720) 4836..5237 - 402 WP_038496209.1 tRNA(fMet)-specific endonuclease VapC Toxin
G6L16_RS23725 (G6L16_023725) 5237..5467 - 231 WP_174005169.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
G6L16_RS23730 (G6L16_023730) 5653..5885 - 233 Protein_8 type II toxin-antitoxin system RelE/ParE family toxin -
G6L16_RS23735 (G6L16_023735) 6252..6392 - 141 WP_003518781.1 hypothetical protein -
G6L16_RS23740 (G6L16_023740) 6763..7533 - 771 WP_038496212.1 4-hydroxy-2-oxoheptanedioate aldolase -
G6L16_RS23745 (G6L16_023745) 7541..8323 - 783 WP_038496215.1 2-oxo-hepta-3-ene-1,7-dioic acid hydratase -
G6L16_RS23750 (G6L16_023750) 8343..9236 - 894 WP_174005170.1 dioxygenase -
G6L16_RS23755 (G6L16_023755) 9482..10216 + 735 WP_174005171.1 GntR family transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..804464 804464


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-124)

Antitoxin

SpoVT-AbrB domain

(7-53)


Sequences

Toxin        


Download         Length: 134 a.a.        Molecular weight: 14922.01 Da        Isoelectric Point: 7.2437

>T281855 WP_038496209.1 NZ_CP124965:c5237-4836 [Agrobacterium fabacearum]
MLKYMLDTNICIFTIKNRPQQVRDAFNRSHDQLCISSVSLMELIYGAEKSASPEKNLSVVEGFAARLEVLPYDELAASHT
GQLRAELARSGTPIGPYDQLIAGHARSRGLVMVTNNRREFDRVPGLRVEDWTS

Download         Length: 402 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8474.53 Da        Isoelectric Point: 4.3867

>AT281855 WP_174005169.1 NZ_CP124965:c5467-5237 [Agrobacterium fabacearum]
MEQGAVFQSNRSQAIRLPKAVALPDDVKRVDIVAVGRTRIIAPAGEIWDSWFEGAEVTSDFMVERDQAAPQEREAF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References