Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 4836..5467 | Replicon | plasmid pAtAF1_95 |
| Accession | NZ_CP124965 | ||
| Organism | Agrobacterium fabacearum strain AF1/95 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | G6L16_RS23720 | Protein ID | WP_038496209.1 |
| Coordinates | 4836..5237 (-) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | G6L16_RS23725 | Protein ID | WP_174005169.1 |
| Coordinates | 5237..5467 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| G6L16_RS23695 (G6L16_023695) | 1221..2246 | + | 1026 | WP_038496201.1 | plasmid partitioning protein RepB | - |
| G6L16_RS23700 (G6L16_023700) | 2449..3663 | + | 1215 | WP_174005167.1 | plasmid replication protein RepC | - |
| G6L16_RS23705 (G6L16_023705) | 3711..3876 | - | 166 | Protein_3 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| G6L16_RS23710 (G6L16_023710) | 3873..4163 | - | 291 | WP_174005168.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
| G6L16_RS23715 (G6L16_023715) | 4548..4760 | + | 213 | WP_284180588.1 | BrnA antitoxin family protein | - |
| G6L16_RS23720 (G6L16_023720) | 4836..5237 | - | 402 | WP_038496209.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| G6L16_RS23725 (G6L16_023725) | 5237..5467 | - | 231 | WP_174005169.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| G6L16_RS23730 (G6L16_023730) | 5653..5885 | - | 233 | Protein_8 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| G6L16_RS23735 (G6L16_023735) | 6252..6392 | - | 141 | WP_003518781.1 | hypothetical protein | - |
| G6L16_RS23740 (G6L16_023740) | 6763..7533 | - | 771 | WP_038496212.1 | 4-hydroxy-2-oxoheptanedioate aldolase | - |
| G6L16_RS23745 (G6L16_023745) | 7541..8323 | - | 783 | WP_038496215.1 | 2-oxo-hepta-3-ene-1,7-dioic acid hydratase | - |
| G6L16_RS23750 (G6L16_023750) | 8343..9236 | - | 894 | WP_174005170.1 | dioxygenase | - |
| G6L16_RS23755 (G6L16_023755) | 9482..10216 | + | 735 | WP_174005171.1 | GntR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..804464 | 804464 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14922.01 Da Isoelectric Point: 7.2437
>T281855 WP_038496209.1 NZ_CP124965:c5237-4836 [Agrobacterium fabacearum]
MLKYMLDTNICIFTIKNRPQQVRDAFNRSHDQLCISSVSLMELIYGAEKSASPEKNLSVVEGFAARLEVLPYDELAASHT
GQLRAELARSGTPIGPYDQLIAGHARSRGLVMVTNNRREFDRVPGLRVEDWTS
MLKYMLDTNICIFTIKNRPQQVRDAFNRSHDQLCISSVSLMELIYGAEKSASPEKNLSVVEGFAARLEVLPYDELAASHT
GQLRAELARSGTPIGPYDQLIAGHARSRGLVMVTNNRREFDRVPGLRVEDWTS
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|