Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ImmA-IrrE/HTH_19(antitoxin) |
| Location | 1847553..1848247 | Replicon | chromosome |
| Accession | NZ_CP124923 | ||
| Organism | Enterococcus faecalis strain EfsC11 | ||
Toxin (Protein)
| Gene name | IrrE | Uniprot ID | S4BLV4 |
| Locus tag | QLQ48_RS09210 | Protein ID | WP_002378467.1 |
| Coordinates | 1847903..1848247 (+) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | ImmA | Uniprot ID | - |
| Locus tag | QLQ48_RS09205 | Protein ID | WP_002392358.1 |
| Coordinates | 1847553..1847885 (+) | Length | 111 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLQ48_RS09160 (1842962) | 1842962..1843279 | - | 318 | WP_002357007.1 | hypothetical protein | - |
| QLQ48_RS09165 (1843499) | 1843499..1844053 | + | 555 | WP_002357006.1 | hypothetical protein | - |
| QLQ48_RS09170 (1844338) | 1844338..1844676 | - | 339 | WP_002364347.1 | hypothetical protein | - |
| QLQ48_RS09175 (1844713) | 1844713..1844922 | - | 210 | WP_002399426.1 | hypothetical protein | - |
| QLQ48_RS09180 (1844977) | 1844977..1845165 | + | 189 | WP_002364350.1 | YegP family protein | - |
| QLQ48_RS09185 (1845191) | 1845191..1845916 | - | 726 | WP_002364352.1 | phage regulatory protein | - |
| QLQ48_RS09190 (1845955) | 1845955..1846266 | - | 312 | WP_002381719.1 | hypothetical protein | - |
| QLQ48_RS09195 (1846863) | 1846863..1847060 | - | 198 | WP_010712611.1 | hypothetical protein | - |
| QLQ48_RS09200 (1847073) | 1847073..1847255 | - | 183 | WP_002358110.1 | hypothetical protein | - |
| QLQ48_RS09205 (1847553) | 1847553..1847885 | + | 333 | WP_002392358.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| QLQ48_RS09210 (1847903) | 1847903..1848247 | + | 345 | WP_002378467.1 | ImmA/IrrE family metallo-endopeptidase | Toxin |
| QLQ48_RS09215 (1848282) | 1848282..1849010 | + | 729 | WP_010784612.1 | potassium channel family protein | - |
| QLQ48_RS09220 (1849110) | 1849110..1850258 | + | 1149 | WP_002388210.1 | site-specific integrase | - |
| QLQ48_RS09225 (1850286) | 1850286..1850729 | - | 444 | WP_002388212.1 | competence type IV pilus minor pilin ComGD | - |
| QLQ48_RS09230 (1850726) | 1850726..1851001 | - | 276 | WP_002364235.1 | competence type IV pilus major pilin ComGC | - |
| QLQ48_RS09235 (1851001) | 1851001..1852047 | - | 1047 | WP_002364236.1 | competence type IV pilus assembly protein ComGB | - |
| QLQ48_RS09240 (1852004) | 1852004..1852972 | - | 969 | WP_002364237.1 | competence type IV pilus ATPase ComGA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1810900..1869106 | 58206 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13712.62 Da Isoelectric Point: 5.5523
>T281829 WP_002378467.1 NZ_CP124923:1847903-1848247 [Enterococcus faecalis]
MKSIKELVEEYEVELVFAPINKRACYEPVKRIIFVNQNLSIEEQEESIFHEFKHVVSHSDYIELYKIPSFRNKMEAEADY
HMFKCLIEKHDGQFNYSNVITHYNLKMGQETYLN
MKSIKELVEEYEVELVFAPINKRACYEPVKRIIFVNQNLSIEEQEESIFHEFKHVVSHSDYIELYKIPSFRNKMEAEADY
HMFKCLIEKHDGQFNYSNVITHYNLKMGQETYLN
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|