Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ImmA-IrrE/HTH_19(antitoxin) |
| Location | 2458818..2459854 | Replicon | chromosome |
| Accession | NZ_CP124921 | ||
| Organism | Enterococcus faecalis strain EfsC12 | ||
Toxin (Protein)
| Gene name | IrrE | Uniprot ID | - |
| Locus tag | QLQ56_RS11815 | Protein ID | WP_156209341.1 |
| Coordinates | 2459201..2459854 (+) | Length | 218 a.a. |
Antitoxin (Protein)
| Gene name | ImmA | Uniprot ID | R3K8V7 |
| Locus tag | QLQ56_RS11810 | Protein ID | WP_002371437.1 |
| Coordinates | 2458818..2459204 (+) | Length | 129 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLQ56_RS11760 (2454635) | 2454635..2455003 | - | 369 | WP_002365216.1 | DUF86 domain-containing protein | - |
| QLQ56_RS11765 (2454987) | 2454987..2455319 | - | 333 | WP_002399122.1 | nucleotidyltransferase domain-containing protein | - |
| QLQ56_RS11770 (2455379) | 2455379..2455681 | - | 303 | WP_224580387.1 | hypothetical protein | - |
| QLQ56_RS11775 (2455742) | 2455742..2455981 | - | 240 | WP_002365219.1 | hypothetical protein | - |
| QLQ56_RS11780 (2455992) | 2455992..2456144 | - | 153 | WP_002365221.1 | hypothetical protein | - |
| QLQ56_RS11785 (2456171) | 2456171..2456395 | - | 225 | WP_002365222.1 | hypothetical protein | - |
| QLQ56_RS11790 (2456802) | 2456802..2456963 | - | 162 | WP_002365224.1 | hypothetical protein | - |
| QLQ56_RS11795 (2456986) | 2456986..2457402 | - | 417 | WP_002380876.1 | DUF961 family protein | - |
| QLQ56_RS11800 (2457402) | 2457402..2457728 | - | 327 | WP_002365226.1 | hypothetical protein | - |
| QLQ56_RS11805 (2457814) | 2457814..2458065 | - | 252 | WP_002365227.1 | hypothetical protein | - |
| QLQ56_RS11810 (2458818) | 2458818..2459204 | + | 387 | WP_002371437.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| QLQ56_RS11815 (2459201) | 2459201..2459854 | + | 654 | WP_156209341.1 | ImmA/IrrE family metallo-endopeptidase | Toxin |
| QLQ56_RS11820 (2459893) | 2459893..2460228 | + | 336 | WP_002365231.1 | helix-turn-helix domain-containing protein | - |
| QLQ56_RS11825 (2460266) | 2460266..2461597 | - | 1332 | WP_282851321.1 | FAD-dependent oxidoreductase | - |
| QLQ56_RS11830 (2461696) | 2461696..2462631 | - | 936 | WP_171803825.1 | aldo/keto reductase | - |
| QLQ56_RS11835 (2462646) | 2462646..2463065 | - | 420 | WP_002365234.1 | MerR family transcriptional regulator | - |
| QLQ56_RS11840 (2463082) | 2463082..2463663 | - | 582 | WP_002380883.1 | histidine phosphatase family protein | - |
| QLQ56_RS11845 (2463885) | 2463885..2464214 | + | 330 | WP_002365236.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 2393533..2460111 | 66578 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 218 a.a. Molecular weight: 26034.98 Da Isoelectric Point: 6.2394
>T281803 WP_156209341.1 NZ_CP124921:2459201-2459854 [Enterococcus faecalis]
MIGLLLVDFISKELYFEAFNFSNELIKEVSYYSSKNIEQVKCFDIEKYVKEVEDVEFVEYTFQKQLKRRMLGSISKVDDE
VIIATNKELMLERKNFTKMHEVMHYYIDIPKINNATHTFSDILLKNGYLMEDFPKEYRANVGASMLMANDQALFYALKKF
YSFEEIAQYFFMSKSALRNRLIEHLMYVNNCTFAHANTLFNNYYFHKETDIYRFIFN
MIGLLLVDFISKELYFEAFNFSNELIKEVSYYSSKNIEQVKCFDIEKYVKEVEDVEFVEYTFQKQLKRRMLGSISKVDDE
VIIATNKELMLERKNFTKMHEVMHYYIDIPKINNATHTFSDILLKNGYLMEDFPKEYRANVGASMLMANDQALFYALKKF
YSFEEIAQYFFMSKSALRNRLIEHLMYVNNCTFAHANTLFNNYYFHKETDIYRFIFN
Download Length: 654 bp
Antitoxin
Download Length: 129 a.a. Molecular weight: 15180.07 Da Isoelectric Point: 4.9147
>AT281803 WP_002371437.1 NZ_CP124921:2458818-2459204 [Enterococcus faecalis]
VTIIKTNERLKQLRENKELTQKELADLLHMDRSVYNKIESGARPIRDNELIQFADFYNVSTDYLTNRTNNPIPPEEKTNV
GQNIISHFRLNTSDMDIEDIEELEEELIDFQDFLIKKAKEKKERNKKN
VTIIKTNERLKQLRENKELTQKELADLLHMDRSVYNKIESGARPIRDNELIQFADFYNVSTDYLTNRTNNPIPPEEKTNV
GQNIISHFRLNTSDMDIEDIEELEEELIDFQDFLIKKAKEKKERNKKN
Download Length: 387 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|