Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ImmA-IrrE/HTH_19(antitoxin)
Location 1801205..1801898 Replicon chromosome
Accession NZ_CP124921
Organism Enterococcus faecalis strain EfsC12

Toxin (Protein)


Gene name IrrE Uniprot ID S4BLV4
Locus tag QLQ56_RS08730 Protein ID WP_002378467.1
Coordinates 1801554..1801898 (+) Length 115 a.a.

Antitoxin (Protein)


Gene name ImmA Uniprot ID -
Locus tag QLQ56_RS08725 Protein ID WP_002364355.1
Coordinates 1801205..1801537 (+) Length 111 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QLQ56_RS08680 (1796677) 1796677..1797411 - 735 WP_002381724.1 ERF family protein -
QLQ56_RS08685 (1797404) 1797404..1797721 - 318 WP_002401330.1 hypothetical protein -
QLQ56_RS08690 (1797941) 1797941..1798495 + 555 WP_002357006.1 hypothetical protein -
QLQ56_RS08695 (1798922) 1798922..1799116 - 195 WP_002381722.1 hypothetical protein -
QLQ56_RS08700 (1799153) 1799153..1799362 - 210 WP_002381721.1 hypothetical protein -
QLQ56_RS08705 (1799417) 1799417..1799605 + 189 WP_002357001.1 YegP family protein -
QLQ56_RS08710 (1799631) 1799631..1800356 - 726 WP_002381720.1 phage regulatory protein -
QLQ56_RS08715 (1800395) 1800395..1800706 - 312 WP_002381719.1 hypothetical protein -
QLQ56_RS08720 (1800717) 1800717..1800893 - 177 WP_002364354.1 helix-turn-helix transcriptional regulator -
QLQ56_RS08725 (1801205) 1801205..1801537 + 333 WP_002364355.1 helix-turn-helix transcriptional regulator Antitoxin
QLQ56_RS08730 (1801554) 1801554..1801898 + 345 WP_002378467.1 ImmA/IrrE family metallo-endopeptidase Toxin
QLQ56_RS08735 (1801934) 1801934..1802662 + 729 WP_002381717.1 potassium channel family protein -
QLQ56_RS08740 (1802762) 1802762..1803910 + 1149 WP_002381716.1 site-specific integrase -
QLQ56_RS08745 (1803938) 1803938..1804381 - 444 WP_002381715.1 competence type IV pilus minor pilin ComGD -
QLQ56_RS08750 (1804378) 1804378..1804653 - 276 WP_002356991.1 competence type IV pilus major pilin ComGC -
QLQ56_RS08755 (1804653) 1804653..1805699 - 1047 WP_047649127.1 competence type IV pilus assembly protein ComGB -
QLQ56_RS08760 (1805656) 1805656..1806624 - 969 WP_002401324.1 competence type IV pilus ATPase ComGA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1755215..1804354 49139


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

IrrE N-terminal-like domain

(22-89)

Antitoxin

Cro/C1-type helix-turn-helix domain

(5-63)


Sequences

Toxin        


Download         Length: 115 a.a.        Molecular weight: 13712.62 Da        Isoelectric Point: 5.5523

>T281802 WP_002378467.1 NZ_CP124921:1801554-1801898 [Enterococcus faecalis]
MKSIKELVEEYEVELVFAPINKRACYEPVKRIIFVNQNLSIEEQEESIFHEFKHVVSHSDYIELYKIPSFRNKMEAEADY
HMFKCLIEKHDGQFNYSNVITHYNLKMGQETYLN

Download         Length: 345 bp

Antitoxin


Download         Length: 111 a.a.        Molecular weight: 12691.16 Da        Isoelectric Point: 4.6307

>AT281802 WP_002364355.1 NZ_CP124921:1801205-1801537 [Enterococcus faecalis]
MNLLERIKKLAKDRDVSIYQLEEEINIGRNTIYQWNKRTPSSDKLEAVANYFNVSVDYLLGRTENPNQAGAKPSDDLDEV
LDNVMSFDGEPLDDHDREVIRAYLKGRFGK

Download         Length: 333 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S4BLV4

Antitoxin

Source ID Structure

References