Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ImmA-IrrE/HTH_26(antitoxin) |
| Location | 2463589..2464284 | Replicon | chromosome |
| Accession | NZ_CP124918 | ||
| Organism | Enterococcus faecalis strain EfsC9 | ||
Toxin (Protein)
| Gene name | IrrE | Uniprot ID | - |
| Locus tag | QLQ61_RS12225 | Protein ID | WP_002388462.1 |
| Coordinates | 2463940..2464284 (+) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | ImmA | Uniprot ID | - |
| Locus tag | QLQ61_RS12220 | Protein ID | WP_002373919.1 |
| Coordinates | 2463589..2463921 (+) | Length | 111 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLQ61_RS12170 (2459433) | 2459433..2459675 | - | 243 | WP_010716251.1 | hypothetical protein | - |
| QLQ61_RS12175 (2459676) | 2459676..2459909 | - | 234 | WP_010716252.1 | hypothetical protein | - |
| QLQ61_RS12180 (2459899) | 2459899..2461113 | - | 1215 | WP_025193233.1 | DEAD/DEAH box helicase | - |
| QLQ61_RS12185 (2461103) | 2461103..2461396 | - | 294 | WP_002418647.1 | VRR-NUC domain-containing protein | - |
| QLQ61_RS12190 (2461399) | 2461399..2462082 | - | 684 | WP_010716254.1 | DUF1642 domain-containing protein | - |
| QLQ61_RS12195 (2462193) | 2462193..2462387 | - | 195 | WP_010716255.1 | hypothetical protein | - |
| QLQ61_RS12200 (2462381) | 2462381..2462581 | - | 201 | WP_010716256.1 | hypothetical protein | - |
| QLQ61_RS12205 (2462587) | 2462587..2462787 | - | 201 | WP_002407633.1 | hypothetical protein | - |
| QLQ61_RS12210 (2462825) | 2462825..2463094 | - | 270 | WP_002365131.1 | hypothetical protein | - |
| QLQ61_RS12215 (2463107) | 2463107..2463289 | - | 183 | WP_002358110.1 | hypothetical protein | - |
| QLQ61_RS12220 (2463589) | 2463589..2463921 | + | 333 | WP_002373919.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| QLQ61_RS12225 (2463940) | 2463940..2464284 | + | 345 | WP_002388462.1 | ImmA/IrrE family metallo-endopeptidase | Toxin |
| QLQ61_RS12230 (2464342) | 2464342..2465070 | + | 729 | WP_010716257.1 | potassium channel family protein | - |
| QLQ61_RS12235 (2465225) | 2465225..2466406 | + | 1182 | WP_010716258.1 | site-specific integrase | - |
| QLQ61_RS12240 (2466509) | 2466509..2466658 | - | 150 | WP_002356321.1 | 50S ribosomal protein L33 | - |
| QLQ61_RS12245 (2466784) | 2466784..2468919 | - | 2136 | WP_002362471.1 | penicillin-binding protein 2 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2422555..2466406 | 43851 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13654.62 Da Isoelectric Point: 5.2241
>T281771 WP_002388462.1 NZ_CP124918:2463940-2464284 [Enterococcus faecalis]
MKSIKELVEEYNVELVFTTLNKRACFDPTYGIIFVNQNLTPSEQEEAIYHELKHVKDHVDIMELYKIPVFRSKMESEAEQ
YMFRSLIEKYEGQYNYSNVIAHYNLKMGQEVYLK
MKSIKELVEEYNVELVFTTLNKRACFDPTYGIIFVNQNLTPSEQEEAIYHELKHVKDHVDIMELYKIPVFRSKMESEAEQ
YMFRSLIEKYEGQYNYSNVIAHYNLKMGQEVYLK
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|