Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ImmA-IrrE/HTH_19(antitoxin) |
Location | 1827816..1828509 | Replicon | chromosome |
Accession | NZ_CP124918 | ||
Organism | Enterococcus faecalis strain EfsC9 |
Toxin (Protein)
Gene name | IrrE | Uniprot ID | - |
Locus tag | QLQ61_RS08960 | Protein ID | WP_002381718.1 |
Coordinates | 1828165..1828509 (+) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | ImmA | Uniprot ID | - |
Locus tag | QLQ61_RS08955 | Protein ID | WP_002364355.1 |
Coordinates | 1827816..1828148 (+) | Length | 111 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLQ61_RS08910 (1823287) | 1823287..1824021 | - | 735 | WP_002381724.1 | ERF family protein | - |
QLQ61_RS08915 (1824105) | 1824105..1824332 | - | 228 | WP_002381723.1 | hypothetical protein | - |
QLQ61_RS08920 (1824552) | 1824552..1825106 | + | 555 | WP_002357006.1 | hypothetical protein | - |
QLQ61_RS08925 (1825533) | 1825533..1825727 | - | 195 | WP_002381722.1 | hypothetical protein | - |
QLQ61_RS08930 (1825764) | 1825764..1825973 | - | 210 | WP_002381721.1 | hypothetical protein | - |
QLQ61_RS08935 (1826028) | 1826028..1826216 | + | 189 | WP_002357001.1 | YegP family protein | - |
QLQ61_RS08940 (1826242) | 1826242..1826967 | - | 726 | WP_002381720.1 | phage regulatory protein | - |
QLQ61_RS08945 (1827006) | 1827006..1827317 | - | 312 | WP_002381719.1 | hypothetical protein | - |
QLQ61_RS08950 (1827328) | 1827328..1827504 | - | 177 | WP_002364354.1 | helix-turn-helix transcriptional regulator | - |
QLQ61_RS08955 (1827816) | 1827816..1828148 | + | 333 | WP_002364355.1 | helix-turn-helix transcriptional regulator | Antitoxin |
QLQ61_RS08960 (1828165) | 1828165..1828509 | + | 345 | WP_002381718.1 | ImmA/IrrE family metallo-endopeptidase | Toxin |
QLQ61_RS08965 (1828545) | 1828545..1829273 | + | 729 | WP_002381717.1 | potassium channel family protein | - |
QLQ61_RS08970 (1829373) | 1829373..1830521 | + | 1149 | WP_002381716.1 | site-specific integrase | - |
QLQ61_RS08975 (1830549) | 1830549..1830992 | - | 444 | WP_002381715.1 | competence type IV pilus minor pilin ComGD | - |
QLQ61_RS08980 (1830989) | 1830989..1831264 | - | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | - |
QLQ61_RS08985 (1831264) | 1831264..1832310 | - | 1047 | WP_002356990.1 | competence type IV pilus assembly protein ComGB | - |
QLQ61_RS08990 (1832267) | 1832267..1833235 | - | 969 | WP_002364362.1 | competence type IV pilus ATPase ComGA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1791337..1849371 | 58034 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13784.69 Da Isoelectric Point: 5.2350
>T281770 WP_002381718.1 NZ_CP124918:1828165-1828509 [Enterococcus faecalis]
MKSIKELVEEYEVELVFAPINKRACYEPVKRIIFVNQNLSIEEQEESIFHEFKHVVSHSDYIELYKIPSFRNKMEAEADY
HMFKCLIEKHDEQFNYSNVITHYNLKMGQETYLN
MKSIKELVEEYEVELVFAPINKRACYEPVKRIIFVNQNLSIEEQEESIFHEFKHVVSHSDYIELYKIPSFRNKMEAEADY
HMFKCLIEKHDEQFNYSNVITHYNLKMGQETYLN
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|