Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ImmA-IrrE/HTH_19(antitoxin) |
Location | 2309686..2310725 | Replicon | chromosome |
Accession | NZ_CP124914 | ||
Organism | Enterococcus faecalis strain EfsC8 |
Toxin (Protein)
Gene name | IrrE | Uniprot ID | - |
Locus tag | QLQ37_RS11020 | Protein ID | WP_010824179.1 |
Coordinates | 2310066..2310725 (+) | Length | 220 a.a. |
Antitoxin (Protein)
Gene name | ImmA | Uniprot ID | - |
Locus tag | QLQ37_RS11015 | Protein ID | WP_010824178.1 |
Coordinates | 2309686..2310069 (+) | Length | 128 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLQ37_RS10960 (2305514) | 2305514..2305882 | - | 369 | WP_002365216.1 | DUF86 domain-containing protein | - |
QLQ37_RS10965 (2305866) | 2305866..2306198 | - | 333 | WP_002399122.1 | nucleotidyltransferase domain-containing protein | - |
QLQ37_RS10970 (2306258) | 2306258..2306581 | - | 324 | WP_002399121.1 | hypothetical protein | - |
QLQ37_RS10975 (2306621) | 2306621..2306782 | - | 162 | WP_229236153.1 | hypothetical protein | - |
QLQ37_RS10980 (2306871) | 2306871..2307023 | - | 153 | WP_002399525.1 | hypothetical protein | - |
QLQ37_RS10985 (2307050) | 2307050..2307274 | - | 225 | WP_010824177.1 | hypothetical protein | - |
QLQ37_RS10990 (2307506) | 2307506..2307694 | + | 189 | WP_002365223.1 | hypothetical protein | - |
QLQ37_RS10995 (2307681) | 2307681..2307842 | - | 162 | WP_002365224.1 | hypothetical protein | - |
QLQ37_RS11000 (2307865) | 2307865..2308281 | - | 417 | WP_002408315.1 | DUF961 family protein | - |
QLQ37_RS11005 (2308281) | 2308281..2308607 | - | 327 | WP_010710084.1 | hypothetical protein | - |
QLQ37_RS11010 (2308693) | 2308693..2308944 | - | 252 | WP_010777935.1 | hypothetical protein | - |
QLQ37_RS11015 (2309686) | 2309686..2310069 | + | 384 | WP_010824178.1 | helix-turn-helix transcriptional regulator | Antitoxin |
QLQ37_RS11020 (2310066) | 2310066..2310725 | + | 660 | WP_010824179.1 | ImmA/IrrE family metallo-endopeptidase | Toxin |
QLQ37_RS11025 (2310741) | 2310741..2311076 | + | 336 | WP_010824180.1 | helix-turn-helix domain-containing protein | - |
QLQ37_RS11030 (2311114) | 2311114..2312445 | - | 1332 | WP_010824181.1 | FAD-dependent oxidoreductase | - |
QLQ37_RS11035 (2312545) | 2312545..2313480 | - | 936 | WP_174115432.1 | aldo/keto reductase | - |
QLQ37_RS11040 (2313495) | 2313495..2313914 | - | 420 | WP_002365234.1 | MerR family transcriptional regulator | - |
QLQ37_RS11045 (2313931) | 2313931..2314512 | - | 582 | WP_002380883.1 | histidine phosphatase family protein | - |
QLQ37_RS11050 (2314734) | 2314734..2315063 | + | 330 | WP_010816770.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 2270911..2317246 | 46335 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 220 a.a. Molecular weight: 26320.31 Da Isoelectric Point: 7.0496
>T281740 WP_010824179.1 NZ_CP124914:2310066-2310725 [Enterococcus faecalis]
MIGLLWVDFISKKLYFEAFNFSNKLIKEVSYYSSKNIEQVKCFDIEKYVKEVEDVEFVEYTFQKQLKRRMLGSISKVDDE
VIITTNKELMLERKNFTKMHEVMHYYIDIPKINNATHTFSDILLKNGYLMEDFPKEYRANVGASMLMANDQALFYALKKF
YSFEEIAQYFFMSKSALRNRLIEHLIYVNNCTFAHANTLFNNYYFHKETDIYRFIFNDS
MIGLLWVDFISKKLYFEAFNFSNKLIKEVSYYSSKNIEQVKCFDIEKYVKEVEDVEFVEYTFQKQLKRRMLGSISKVDDE
VIITTNKELMLERKNFTKMHEVMHYYIDIPKINNATHTFSDILLKNGYLMEDFPKEYRANVGASMLMANDQALFYALKKF
YSFEEIAQYFFMSKSALRNRLIEHLIYVNNCTFAHANTLFNNYYFHKETDIYRFIFNDS
Download Length: 660 bp
Antitoxin
Download Length: 128 a.a. Molecular weight: 15032.08 Da Isoelectric Point: 5.3750
>AT281740 WP_010824178.1 NZ_CP124914:2309686-2310069 [Enterococcus faecalis]
VQPLAKRLQLLREEKEWTKTYVAKQLGLNNLGTYANWEYGTREPDSEMLSKIASLYDVSTDFLLGRTEERIHLNDKEKIG
KNIISHFRLNTSDMDIEDIEELEEELIDFQDFLIKKAKEKKKRNKKD
VQPLAKRLQLLREEKEWTKTYVAKQLGLNNLGTYANWEYGTREPDSEMLSKIASLYDVSTDFLLGRTEERIHLNDKEKIG
KNIISHFRLNTSDMDIEDIEELEEELIDFQDFLIKKAKEKKKRNKKD
Download Length: 384 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|