Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relE-dinJ/YafQ-DinJ |
Location | 2668273..2668807 | Replicon | chromosome |
Accession | NZ_CP124913 | ||
Organism | Enterococcus faecalis strain EfsC20 |
Toxin (Protein)
Gene name | relE | Uniprot ID | R3JX52 |
Locus tag | QLQ32_RS12815 | Protein ID | WP_002360769.1 |
Coordinates | 2668273..2668548 (-) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | dinJ | Uniprot ID | R3H6P0 |
Locus tag | QLQ32_RS12820 | Protein ID | WP_002369771.1 |
Coordinates | 2668541..2668807 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLQ32_RS12785 (2663321) | 2663321..2664259 | - | 939 | WP_002370935.1 | 2-dehydropantoate 2-reductase | - |
QLQ32_RS12790 (2664387) | 2664387..2664716 | - | 330 | WP_002358661.1 | LPXTG cell wall anchor domain-containing protein | - |
QLQ32_RS12795 (2664746) | 2664746..2664931 | + | 186 | WP_002358660.1 | hypothetical protein | - |
QLQ32_RS12800 (2664963) | 2664963..2665571 | + | 609 | Protein_2512 | IS6 family transposase | - |
QLQ32_RS12805 (2666240) | 2666240..2667214 | - | 975 | WP_002355428.1 | choloylglycine hydrolase | - |
QLQ32_RS12810 (2667438) | 2667438..2668082 | + | 645 | WP_002377952.1 | IS6 family transposase | - |
QLQ32_RS12815 (2668273) | 2668273..2668548 | - | 276 | WP_002360769.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
QLQ32_RS12820 (2668541) | 2668541..2668807 | - | 267 | WP_002369771.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
QLQ32_RS12825 (2668918) | 2668918..2669502 | - | 585 | WP_002377949.1 | thermonuclease family protein | - |
QLQ32_RS12830 (2669526) | 2669526..2669942 | - | 417 | WP_010710134.1 | single-stranded DNA-binding protein | - |
QLQ32_RS12835 (2670018) | 2670018..2670266 | - | 249 | WP_002360773.1 | DUF3850 domain-containing protein | - |
QLQ32_RS12840 (2670279) | 2670279..2670779 | - | 501 | WP_002360775.1 | DnaJ domain-containing protein | - |
QLQ32_RS12845 (2670812) | 2670812..2671078 | - | 267 | WP_002377947.1 | hypothetical protein | - |
QLQ32_RS12850 (2671670) | 2671670..2672158 | - | 489 | WP_010710133.1 | hypothetical protein | - |
QLQ32_RS12855 (2672164) | 2672164..2672757 | - | 594 | WP_002414802.1 | replication-relaxation family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10732.58 Da Isoelectric Point: 9.6918
>T281734 WP_002360769.1 NZ_CP124913:c2668548-2668273 [Enterococcus faecalis]
MLEIFYTNQFKKDFKKAKKQGKNLEKLKEVLVLLQEQQTLPPKYKDHALTGNYIGTRECHIEPDWLLIYKIDGDKLILTL
ARIGSHSELFR
MLEIFYTNQFKKDFKKAKKQGKNLEKLKEVLVLLQEQQTLPPKYKDHALTGNYIGTRECHIEPDWLLIYKIDGDKLILTL
ARIGSHSELFR
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M2AEA7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M2AED7 |