Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 294107..294678 | Replicon | chromosome |
Accession | NZ_CP124913 | ||
Organism | Enterococcus faecalis strain EfsC20 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | QLQ32_RS01425 | Protein ID | WP_002354774.1 |
Coordinates | 294337..294678 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | R3JGB1 |
Locus tag | QLQ32_RS01420 | Protein ID | WP_002354773.1 |
Coordinates | 294107..294337 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLQ32_RS01400 (289481) | 289481..291097 | - | 1617 | WP_002378864.1 | phosphatase PAP2/LCP family protein | - |
QLQ32_RS01405 (291782) | 291782..292420 | + | 639 | WP_002378863.1 | lytic polysaccharide monooxygenase | - |
QLQ32_RS01410 (292587) | 292587..293579 | - | 993 | WP_002378862.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
QLQ32_RS01415 (293718) | 293718..293933 | + | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
QLQ32_RS01420 (294107) | 294107..294337 | + | 231 | WP_002354773.1 | hypothetical protein | Antitoxin |
QLQ32_RS01425 (294337) | 294337..294678 | + | 342 | WP_002354774.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
QLQ32_RS01430 (295049) | 295049..298663 | + | 3615 | WP_002389470.1 | DNA-directed RNA polymerase subunit beta | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13156.40 Da Isoelectric Point: 9.3984
>T281727 WP_002354774.1 NZ_CP124913:294337-294678 [Enterococcus faecalis]
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETQGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETQGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|