281720

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) omega-epsilon-zeta/zeta-epsilon
Location 11853..12549 Replicon plasmid p1_EfsC61_rep2
Accession NZ_CP124912
Organism Enterococcus faecalis strain EfsC61

Toxin (Protein)


Gene name zeta Uniprot ID A0A828ZQ58
Locus tag QLQ53_RS14750 Protein ID WP_002334977.1
Coordinates 11853..12275 (-) Length 141 a.a.

Antitoxin (Protein)


Gene name epsilon Uniprot ID Q9AL01
Locus tag QLQ53_RS14755 Protein ID WP_002331065.1
Coordinates 12277..12549 (-) Length 91 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QLQ53_RS14710 (QLQ53_14710) 7122..7871 - 750 WP_000933358.1 ABC transporter permease -
QLQ53_RS14715 (QLQ53_14715) 7864..8781 - 918 WP_002346952.1 ATP-binding cassette domain-containing protein -
QLQ53_RS14720 (QLQ53_14720) 8964..9578 - 615 WP_000395511.1 bacitracin resistance transcriptional activator BcrR -
QLQ53_RS14725 (QLQ53_14725) 9568..9894 - 327 WP_002387760.1 DNA-binding protein -
QLQ53_RS14730 (QLQ53_14730) 9931..10095 + 165 WP_001808810.1 helix-turn-helix transcriptional regulator -
QLQ53_RS14735 (QLQ53_14735) 10134..10814 + 681 WP_000191454.1 IS6-like element ISEnfa1 family transposase -
QLQ53_RS14740 (QLQ53_14740) 10908..11024 - 117 WP_282854073.1 LPXTG cell wall anchor domain-containing protein -
QLQ53_RS14745 (QLQ53_14745) 11119..11799 - 681 WP_001015311.1 IS6-like element IS1216 family transposase -
QLQ53_RS14750 (QLQ53_14750) 11853..12275 - 423 WP_002334977.1 zeta toxin family protein Toxin
QLQ53_RS14755 (QLQ53_14755) 12277..12549 - 273 WP_002331065.1 antitoxin Antitoxin
QLQ53_RS14760 (QLQ53_14760) 12566..12775 - 210 WP_000527318.1 peptide-binding protein -
QLQ53_RS14765 (QLQ53_14765) 12874..13770 - 897 WP_002334978.1 AAA family ATPase -
QLQ53_RS14770 (QLQ53_14770) 14068..14640 - 573 WP_001079938.1 HTH domain-containing protein -
QLQ53_RS14775 (QLQ53_14775) 14916..15710 - 795 WP_001096887.1 aminoglycoside O-phosphotransferase APH(3')-IIIa -
QLQ53_RS14780 (QLQ53_14780) 15803..16345 - 543 WP_000627290.1 streptothricin N-acetyltransferase Sat4 -
QLQ53_RS14785 (QLQ53_14785) 16342..17250 - 909 WP_001255866.1 aminoglycoside nucleotidyltransferase ANT(6)-Ia -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aph(3')-III / ant(6)-Ia - 1..57398 57398
- inside IScluster/Tn aph(3')-III / ant(6)-Ia - 5409..26533 21124


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Zeta toxin domain

(28-134)

Antitoxin

Bacterial epsilon antitoxin

(2-90)


Sequences

Toxin        


Download         Length: 141 a.a.        Molecular weight: 15667.64 Da        Isoelectric Point: 5.2420

>T281720 WP_002334977.1 NZ_CP124912:c12275-11853 [Enterococcus faecalis]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEALISRLSDQGYNLVIEGTGRTTDVPIQTATMLQSGSVAKF

Download         Length: 423 bp

Antitoxin


Download         Length: 91 a.a.        Molecular weight: 10733.17 Da        Isoelectric Point: 4.4865

>AT281720 WP_002331065.1 NZ_CP124912:c12549-12277 [Enterococcus faecalis]
MAVTYEKTFEIEIINELSASVYNRVLNYVLNHELDTKNTRLLEVNLLNQLEVAQEVDLFQQPFEELQAIHEYWRSMNQYS
KQILNKEKVA

Download         Length: 273 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A828ZQ58

Antitoxin

Source ID Structure
AlphaFold DB A0A828ZL55

References