Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 2877594..2878165 | Replicon | chromosome |
Accession | NZ_CP124911 | ||
Organism | Enterococcus faecalis strain EfsC61 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | QLQ53_RS14180 | Protein ID | WP_002354774.1 |
Coordinates | 2877594..2877935 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | R3JGB1 |
Locus tag | QLQ53_RS14185 | Protein ID | WP_002354773.1 |
Coordinates | 2877935..2878165 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLQ53_RS14175 (2873609) | 2873609..2877223 | - | 3615 | WP_002389470.1 | DNA-directed RNA polymerase subunit beta | - |
QLQ53_RS14180 (2877594) | 2877594..2877935 | - | 342 | WP_002354774.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
QLQ53_RS14185 (2877935) | 2877935..2878165 | - | 231 | WP_002354773.1 | hypothetical protein | Antitoxin |
QLQ53_RS14190 (2878572) | 2878572..2878787 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
QLQ53_RS14195 (2878926) | 2878926..2879918 | + | 993 | WP_002365428.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
QLQ53_RS14200 (2879985) | 2879985..2880617 | - | 633 | WP_002358972.1 | RloB family protein | - |
QLQ53_RS14205 (2880626) | 2880626..2881921 | - | 1296 | WP_010785619.1 | ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13156.40 Da Isoelectric Point: 9.3984
>T281717 WP_002354774.1 NZ_CP124911:c2877935-2877594 [Enterococcus faecalis]
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETQGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETQGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|