Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ImmA-IrrE/HTH_19(antitoxin) |
| Location | 2567541..2568574 | Replicon | chromosome |
| Accession | NZ_CP124911 | ||
| Organism | Enterococcus faecalis strain EfsC61 | ||
Toxin (Protein)
| Gene name | IrrE | Uniprot ID | R3K9G6 |
| Locus tag | QLQ53_RS12750 | Protein ID | WP_002365229.1 |
| Coordinates | 2567921..2568574 (+) | Length | 218 a.a. |
Antitoxin (Protein)
| Gene name | ImmA | Uniprot ID | - |
| Locus tag | QLQ53_RS12745 | Protein ID | WP_002365228.1 |
| Coordinates | 2567541..2567924 (+) | Length | 128 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLQ53_RS12695 (2563370) | 2563370..2563738 | - | 369 | WP_002365216.1 | DUF86 domain-containing protein | - |
| QLQ53_RS12700 (2563722) | 2563722..2564054 | - | 333 | WP_002399122.1 | nucleotidyltransferase domain-containing protein | - |
| QLQ53_RS12705 (2564114) | 2564114..2564437 | - | 324 | WP_002399121.1 | hypothetical protein | - |
| QLQ53_RS12710 (2564477) | 2564477..2564716 | - | 240 | WP_002365219.1 | hypothetical protein | - |
| QLQ53_RS12715 (2564727) | 2564727..2564879 | - | 153 | WP_002365221.1 | hypothetical protein | - |
| QLQ53_RS12720 (2564906) | 2564906..2565130 | - | 225 | WP_002365222.1 | hypothetical protein | - |
| QLQ53_RS12725 (2565537) | 2565537..2565698 | - | 162 | WP_002365224.1 | hypothetical protein | - |
| QLQ53_RS12730 (2565721) | 2565721..2566137 | - | 417 | WP_002365225.1 | DUF961 family protein | - |
| QLQ53_RS12735 (2566137) | 2566137..2566463 | - | 327 | WP_002365226.1 | hypothetical protein | - |
| QLQ53_RS12740 (2566549) | 2566549..2566800 | - | 252 | WP_002365227.1 | hypothetical protein | - |
| QLQ53_RS12745 (2567541) | 2567541..2567924 | + | 384 | WP_002365228.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| QLQ53_RS12750 (2567921) | 2567921..2568574 | + | 654 | WP_002365229.1 | ImmA/IrrE family metallo-endopeptidase | Toxin |
| QLQ53_RS12755 (2568613) | 2568613..2568948 | + | 336 | WP_002365231.1 | helix-turn-helix domain-containing protein | - |
| QLQ53_RS12760 (2568986) | 2568986..2570317 | - | 1332 | WP_002411615.1 | FAD-dependent oxidoreductase | - |
| QLQ53_RS12765 (2570416) | 2570416..2571291 | - | 876 | WP_010785599.1 | aldo/keto reductase | - |
| QLQ53_RS12770 (2571367) | 2571367..2571786 | - | 420 | WP_002365234.1 | MerR family transcriptional regulator | - |
| QLQ53_RS12775 (2571803) | 2571803..2572384 | - | 582 | WP_002411620.1 | histidine phosphatase family protein | - |
| QLQ53_RS12780 (2572584) | 2572584..2572933 | + | 350 | Protein_2489 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | erm(B) / tet(L) | - | 2559394..2618069 | 58675 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 218 a.a. Molecular weight: 26065.01 Da Isoelectric Point: 6.2394
>T281705 WP_002365229.1 NZ_CP124911:2567921-2568574 [Enterococcus faecalis]
MIGLLLVDFISKELYFEAFNFSNELIKEVSYYSSKNIEQVKCFDIEKYVKEVEDVEFVEYTFQKQLKRRMLGSISKVDDE
VIITTNKELMLERKNFTKMHEVMHYYIDIPKINNATHTFSDILLKNGYLMEDFPKEYRANVGASMLMANDQALFYALKKF
YSFEEIAQYFFMSKSALRNRLIEHLMYVNNCTFAHANTLFNNYYFHKETDIYRFIFN
MIGLLLVDFISKELYFEAFNFSNELIKEVSYYSSKNIEQVKCFDIEKYVKEVEDVEFVEYTFQKQLKRRMLGSISKVDDE
VIITTNKELMLERKNFTKMHEVMHYYIDIPKINNATHTFSDILLKNGYLMEDFPKEYRANVGASMLMANDQALFYALKKF
YSFEEIAQYFFMSKSALRNRLIEHLMYVNNCTFAHANTLFNNYYFHKETDIYRFIFN
Download Length: 654 bp
Antitoxin
Download Length: 128 a.a. Molecular weight: 15032.03 Da Isoelectric Point: 5.1063
>AT281705 WP_002365228.1 NZ_CP124911:2567541-2567924 [Enterococcus faecalis]
VQPLAKRLQLLREEKEWTKTYVAKQLGLNNLGTYANWEYGTREPDSEMLSKIASLYDVSTDFLLGRTEERIHLNDKEKIG
KNIISHFRLNTSDMDIEDIEELEEELIDFQDFLIKKAKEKKERNKKN
VQPLAKRLQLLREEKEWTKTYVAKQLGLNNLGTYANWEYGTREPDSEMLSKIASLYDVSTDFLLGRTEERIHLNDKEKIG
KNIISHFRLNTSDMDIEDIEELEEELIDFQDFLIKKAKEKKERNKKN
Download Length: 384 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|