Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ImmA-IrrE/HTH_19(antitoxin) |
Location | 2441409..2442104 | Replicon | chromosome |
Accession | NZ_CP124911 | ||
Organism | Enterococcus faecalis strain EfsC61 |
Toxin (Protein)
Gene name | IrrE | Uniprot ID | - |
Locus tag | QLQ53_RS12035 | Protein ID | WP_002385632.1 |
Coordinates | 2441760..2442104 (+) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | ImmA | Uniprot ID | - |
Locus tag | QLQ53_RS12030 | Protein ID | WP_002385633.1 |
Coordinates | 2441409..2441741 (+) | Length | 111 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLQ53_RS11975 (2436771) | 2436771..2437586 | - | 816 | WP_010830409.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
QLQ53_RS11980 (2437549) | 2437549..2438565 | - | 1017 | WP_002393794.1 | RecT family recombinase | - |
QLQ53_RS11985 (2438668) | 2438668..2438892 | - | 225 | WP_002370012.1 | hypothetical protein | - |
QLQ53_RS11990 (2438889) | 2438889..2439188 | - | 300 | WP_002385643.1 | hypothetical protein | - |
QLQ53_RS11995 (2439255) | 2439255..2439434 | - | 180 | WP_010785685.1 | hypothetical protein | - |
QLQ53_RS12000 (2439470) | 2439470..2439739 | - | 270 | WP_002385641.1 | hypothetical protein | - |
QLQ53_RS12005 (2439815) | 2439815..2440129 | + | 315 | WP_002385638.1 | hypothetical protein | - |
QLQ53_RS12010 (2440110) | 2440110..2440238 | - | 129 | WP_002385637.1 | hypothetical protein | - |
QLQ53_RS12015 (2440254) | 2440254..2440430 | - | 177 | WP_002385636.1 | helix-turn-helix transcriptional regulator | - |
QLQ53_RS12020 (2440514) | 2440514..2440897 | + | 384 | WP_002385635.1 | DUF2513 domain-containing protein | - |
QLQ53_RS12025 (2440894) | 2440894..2441103 | - | 210 | WP_002415277.1 | DUF2829 domain-containing protein | - |
QLQ53_RS12030 (2441409) | 2441409..2441741 | + | 333 | WP_002385633.1 | helix-turn-helix transcriptional regulator | Antitoxin |
QLQ53_RS12035 (2441760) | 2441760..2442104 | + | 345 | WP_002385632.1 | ImmA/IrrE family metallo-endopeptidase | Toxin |
QLQ53_RS12040 (2442162) | 2442162..2442890 | + | 729 | WP_002385631.1 | potassium channel family protein | - |
QLQ53_RS12045 (2443045) | 2443045..2444226 | + | 1182 | WP_002385630.1 | site-specific integrase | - |
QLQ53_RS12050 (2444329) | 2444329..2444478 | - | 150 | WP_002356321.1 | 50S ribosomal protein L33 | - |
QLQ53_RS12055 (2444604) | 2444604..2446742 | - | 2139 | WP_282853864.1 | penicillin-binding transpeptidase domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2402149..2444226 | 42077 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13594.61 Da Isoelectric Point: 5.6229
>T281704 WP_002385632.1 NZ_CP124911:2441760-2442104 [Enterococcus faecalis]
MKSIKELVEEYNVELVFTTLNKRACFDPTYGIIFVNQNLTPSEQEEAIYHELKHVKEHVDIMALYKIPVFRSKMEAEAEQ
YMFRSLIEKYEGQYNYSNVIAHYNLKMGQEVYLK
MKSIKELVEEYNVELVFTTLNKRACFDPTYGIIFVNQNLTPSEQEEAIYHELKHVKEHVDIMALYKIPVFRSKMEAEAEQ
YMFRSLIEKYEGQYNYSNVIAHYNLKMGQEVYLK
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|