Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ImmA-IrrE/HTH_19(antitoxin)
Location 2441409..2442104 Replicon chromosome
Accession NZ_CP124911
Organism Enterococcus faecalis strain EfsC61

Toxin (Protein)


Gene name IrrE Uniprot ID -
Locus tag QLQ53_RS12035 Protein ID WP_002385632.1
Coordinates 2441760..2442104 (+) Length 115 a.a.

Antitoxin (Protein)


Gene name ImmA Uniprot ID -
Locus tag QLQ53_RS12030 Protein ID WP_002385633.1
Coordinates 2441409..2441741 (+) Length 111 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QLQ53_RS11975 (2436771) 2436771..2437586 - 816 WP_010830409.1 PD-(D/E)XK nuclease-like domain-containing protein -
QLQ53_RS11980 (2437549) 2437549..2438565 - 1017 WP_002393794.1 RecT family recombinase -
QLQ53_RS11985 (2438668) 2438668..2438892 - 225 WP_002370012.1 hypothetical protein -
QLQ53_RS11990 (2438889) 2438889..2439188 - 300 WP_002385643.1 hypothetical protein -
QLQ53_RS11995 (2439255) 2439255..2439434 - 180 WP_010785685.1 hypothetical protein -
QLQ53_RS12000 (2439470) 2439470..2439739 - 270 WP_002385641.1 hypothetical protein -
QLQ53_RS12005 (2439815) 2439815..2440129 + 315 WP_002385638.1 hypothetical protein -
QLQ53_RS12010 (2440110) 2440110..2440238 - 129 WP_002385637.1 hypothetical protein -
QLQ53_RS12015 (2440254) 2440254..2440430 - 177 WP_002385636.1 helix-turn-helix transcriptional regulator -
QLQ53_RS12020 (2440514) 2440514..2440897 + 384 WP_002385635.1 DUF2513 domain-containing protein -
QLQ53_RS12025 (2440894) 2440894..2441103 - 210 WP_002415277.1 DUF2829 domain-containing protein -
QLQ53_RS12030 (2441409) 2441409..2441741 + 333 WP_002385633.1 helix-turn-helix transcriptional regulator Antitoxin
QLQ53_RS12035 (2441760) 2441760..2442104 + 345 WP_002385632.1 ImmA/IrrE family metallo-endopeptidase Toxin
QLQ53_RS12040 (2442162) 2442162..2442890 + 729 WP_002385631.1 potassium channel family protein -
QLQ53_RS12045 (2443045) 2443045..2444226 + 1182 WP_002385630.1 site-specific integrase -
QLQ53_RS12050 (2444329) 2444329..2444478 - 150 WP_002356321.1 50S ribosomal protein L33 -
QLQ53_RS12055 (2444604) 2444604..2446742 - 2139 WP_282853864.1 penicillin-binding transpeptidase domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2402149..2444226 42077


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

IrrE N-terminal-like domain

(21-86)

Antitoxin

Cro/C1-type helix-turn-helix domain

(5-63)


Sequences

Toxin        


Download         Length: 115 a.a.        Molecular weight: 13594.61 Da        Isoelectric Point: 5.6229

>T281704 WP_002385632.1 NZ_CP124911:2441760-2442104 [Enterococcus faecalis]
MKSIKELVEEYNVELVFTTLNKRACFDPTYGIIFVNQNLTPSEQEEAIYHELKHVKEHVDIMALYKIPVFRSKMEAEAEQ
YMFRSLIEKYEGQYNYSNVIAHYNLKMGQEVYLK

Download         Length: 345 bp

Antitoxin


Download         Length: 111 a.a.        Molecular weight: 12677.13 Da        Isoelectric Point: 4.6211

>AT281704 WP_002385633.1 NZ_CP124911:2441409-2441741 [Enterococcus faecalis]
MNLLERIKKLAKDRDVSIYQLEEEINIGRNTIYQWNKRTPSSDKLEAVANYFNVSVDYLLGRTENPNQAGAKPSDDLDDV
LDNVMSFDGEPLDDHDREVIRAYLKGRFGK

Download         Length: 333 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References