Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 391849..392431 | Replicon | chromosome |
Accession | NZ_CP124911 | ||
Organism | Enterococcus faecalis strain EfsC61 |
Toxin (Protein)
Gene name | zeta | Uniprot ID | A0A0M2AE74 |
Locus tag | QLQ53_RS02000 | Protein ID | WP_002355414.1 |
Coordinates | 392123..392431 (+) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | Q9AL19 |
Locus tag | QLQ53_RS01995 | Protein ID | WP_002326825.1 |
Coordinates | 391849..392121 (+) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLQ53_RS01975 (388355) | 388355..389517 | - | 1163 | Protein_365 | IS3 family transposase | - |
QLQ53_RS01980 (389774) | 389774..390733 | + | 960 | WP_000221326.1 | IS30-like element IS6770 family transposase | - |
QLQ53_RS01985 (390759) | 390759..391547 | + | 789 | WP_282854052.1 | ParA family protein | - |
QLQ53_RS01990 (391618) | 391618..391832 | + | 215 | Protein_368 | peptide-binding protein | - |
QLQ53_RS01995 (391849) | 391849..392121 | + | 273 | WP_002326825.1 | antitoxin | Antitoxin |
QLQ53_RS02000 (392123) | 392123..392431 | + | 309 | WP_002355414.1 | zeta toxin family protein | Toxin |
QLQ53_RS02005 (392511) | 392511..392933 | - | 423 | WP_080005963.1 | tyrosine-type recombinase/integrase | - |
QLQ53_RS02010 (392984) | 392984..393484 | - | 501 | WP_002411594.1 | HAD family hydrolase | - |
QLQ53_RS02015 (393489) | 393489..394256 | - | 768 | WP_002355416.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
QLQ53_RS02020 (394744) | 394744..395169 | + | 426 | WP_002355418.1 | galactose-6-phosphate isomerase subunit LacA | - |
QLQ53_RS02025 (395186) | 395186..395701 | + | 516 | WP_002345825.1 | galactose-6-phosphate isomerase subunit LacB | - |
QLQ53_RS02030 (395712) | 395712..396644 | + | 933 | WP_002363040.1 | tagatose-6-phosphate kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | bsh / esp | 375999..424972 | 48973 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11525.91 Da Isoelectric Point: 5.7251
>T281701 WP_002355414.1 NZ_CP124911:392123-392431 [Enterococcus faecalis]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKHATSYSNQLVKLN
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKHATSYSNQLVKLN
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M2AE74 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M2AF93 |