Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
| Location | 39303..39867 | Replicon | plasmid p1_EfsC33_rep9a |
| Accession | NZ_CP124909 | ||
| Organism | Enterococcus faecalis strain EfsC33 | ||
Toxin (Protein)
| Gene name | zeta | Uniprot ID | A0A0M2A908 |
| Locus tag | QLQ33_RS14390 | Protein ID | WP_010724880.1 |
| Coordinates | 39577..39867 (+) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | epsilon | Uniprot ID | Q9AL01 |
| Locus tag | QLQ33_RS14385 | Protein ID | WP_002331065.1 |
| Coordinates | 39303..39575 (+) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLQ33_RS14355 (34602) | 34602..35510 | + | 909 | WP_001255866.1 | aminoglycoside nucleotidyltransferase ANT(6)-Ia | - |
| QLQ33_RS14360 (35507) | 35507..36049 | + | 543 | WP_000627290.1 | streptothricin N-acetyltransferase Sat4 | - |
| QLQ33_RS14365 (36142) | 36142..36936 | + | 795 | WP_001096887.1 | aminoglycoside O-phosphotransferase APH(3')-IIIa | - |
| QLQ33_RS14370 (37212) | 37212..37784 | + | 573 | WP_001079938.1 | HTH domain-containing protein | - |
| QLQ33_RS14375 (38082) | 38082..38978 | + | 897 | WP_002334978.1 | AAA family ATPase | - |
| QLQ33_RS14380 (39077) | 39077..39286 | + | 210 | WP_000527318.1 | peptide-binding protein | - |
| QLQ33_RS14385 (39303) | 39303..39575 | + | 273 | WP_002331065.1 | antitoxin | Antitoxin |
| QLQ33_RS14390 (39577) | 39577..39867 | + | 291 | WP_010724880.1 | zeta toxin family protein | Toxin |
| QLQ33_RS14395 (39895) | 39895..40575 | + | 681 | WP_001015311.1 | IS6-like element IS1216 family transposase | - |
| QLQ33_RS14400 (40623) | 40623..40697 | - | 75 | Protein_44 | rRNA adenine methyltransferase | - |
| QLQ33_RS14405 (40702) | 40702..41439 | - | 738 | WP_002292226.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
| QLQ33_RS14410 (41564) | 41564..41647 | - | 84 | WP_001814874.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
| QLQ33_RS14415 (41770) | 41770..41937 | - | 168 | Protein_47 | peptide-binding protein | - |
| QLQ33_RS14420 (42071) | 42071..42331 | - | 261 | Protein_48 | topoisomerase DNA-binding C4 zinc finger domain-containing protein | - |
| QLQ33_RS14425 (42511) | 42511..43191 | + | 681 | WP_001015311.1 | IS6-like element IS1216 family transposase | - |
| QLQ33_RS14430 (43246) | 43246..43995 | + | 750 | Protein_50 | LPXTG cell wall anchor domain-containing protein | - |
| QLQ33_RS14435 (44057) | 44057..44410 | + | 354 | WP_002379922.1 | pheromone response system RNA-binding regulator PrgU | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | ant(6)-Ia / aph(3')-III / erm(B) | cylR2 / cylR1 / cylL / cylS / cylM / cylB / cylA / cylI / asa1 | 1..104476 | 104476 | |
| - | inside | IScluster/Tn | ant(6)-Ia / aph(3')-III / erm(B) | asa1 | 30874..52071 | 21197 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 10902.37 Da Isoelectric Point: 5.8599
>T281691 WP_010724880.1 NZ_CP124909:39577-39867 [Enterococcus faecalis]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KRFCCKVLNLLSNKVE
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KRFCCKVLNLLSNKVE
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M2A908 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A828ZL55 |