281691

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) omega-epsilon-zeta/zeta-epsilon
Location 39303..39867 Replicon plasmid p1_EfsC33_rep9a
Accession NZ_CP124909
Organism Enterococcus faecalis strain EfsC33

Toxin (Protein)


Gene name zeta Uniprot ID A0A0M2A908
Locus tag QLQ33_RS14390 Protein ID WP_010724880.1
Coordinates 39577..39867 (+) Length 97 a.a.

Antitoxin (Protein)


Gene name epsilon Uniprot ID Q9AL01
Locus tag QLQ33_RS14385 Protein ID WP_002331065.1
Coordinates 39303..39575 (+) Length 91 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QLQ33_RS14355 (34602) 34602..35510 + 909 WP_001255866.1 aminoglycoside nucleotidyltransferase ANT(6)-Ia -
QLQ33_RS14360 (35507) 35507..36049 + 543 WP_000627290.1 streptothricin N-acetyltransferase Sat4 -
QLQ33_RS14365 (36142) 36142..36936 + 795 WP_001096887.1 aminoglycoside O-phosphotransferase APH(3')-IIIa -
QLQ33_RS14370 (37212) 37212..37784 + 573 WP_001079938.1 HTH domain-containing protein -
QLQ33_RS14375 (38082) 38082..38978 + 897 WP_002334978.1 AAA family ATPase -
QLQ33_RS14380 (39077) 39077..39286 + 210 WP_000527318.1 peptide-binding protein -
QLQ33_RS14385 (39303) 39303..39575 + 273 WP_002331065.1 antitoxin Antitoxin
QLQ33_RS14390 (39577) 39577..39867 + 291 WP_010724880.1 zeta toxin family protein Toxin
QLQ33_RS14395 (39895) 39895..40575 + 681 WP_001015311.1 IS6-like element IS1216 family transposase -
QLQ33_RS14400 (40623) 40623..40697 - 75 Protein_44 rRNA adenine methyltransferase -
QLQ33_RS14405 (40702) 40702..41439 - 738 WP_002292226.1 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) -
QLQ33_RS14410 (41564) 41564..41647 - 84 WP_001814874.1 23S rRNA methyltransferase attenuation leader peptide -
QLQ33_RS14415 (41770) 41770..41937 - 168 Protein_47 peptide-binding protein -
QLQ33_RS14420 (42071) 42071..42331 - 261 Protein_48 topoisomerase DNA-binding C4 zinc finger domain-containing protein -
QLQ33_RS14425 (42511) 42511..43191 + 681 WP_001015311.1 IS6-like element IS1216 family transposase -
QLQ33_RS14430 (43246) 43246..43995 + 750 Protein_50 LPXTG cell wall anchor domain-containing protein -
QLQ33_RS14435 (44057) 44057..44410 + 354 WP_002379922.1 pheromone response system RNA-binding regulator PrgU -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid ant(6)-Ia / aph(3')-III / erm(B) cylR2 / cylR1 / cylL / cylS / cylM / cylB / cylA / cylI / asa1 1..104476 104476
- inside IScluster/Tn ant(6)-Ia / aph(3')-III / erm(B) asa1 30874..52071 21197


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Zeta toxin domain

(27-81)

Antitoxin

Bacterial epsilon antitoxin

(2-90)


Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 10902.37 Da        Isoelectric Point: 5.8599

>T281691 WP_010724880.1 NZ_CP124909:39577-39867 [Enterococcus faecalis]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KRFCCKVLNLLSNKVE

Download         Length: 291 bp

Antitoxin


Download         Length: 91 a.a.        Molecular weight: 10733.17 Da        Isoelectric Point: 4.4865

>AT281691 WP_002331065.1 NZ_CP124909:39303-39575 [Enterococcus faecalis]
MAVTYEKTFEIEIINELSASVYNRVLNYVLNHELDTKNTRLLEVNLLNQLEVAQEVDLFQQPFEELQAIHEYWRSMNQYS
KQILNKEKVA

Download         Length: 273 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0M2A908

Antitoxin

Source ID Structure
AlphaFold DB A0A828ZL55

References