Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 2811689..2812260 | Replicon | chromosome |
Accession | NZ_CP124908 | ||
Organism | Enterococcus faecalis strain EfsC33 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | R3GRA7 |
Locus tag | QLQ33_RS13610 | Protein ID | WP_002360937.1 |
Coordinates | 2811689..2812030 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | R3JGB1 |
Locus tag | QLQ33_RS13615 | Protein ID | WP_002354773.1 |
Coordinates | 2812030..2812260 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLQ33_RS13605 (2807704) | 2807704..2811318 | - | 3615 | WP_002389470.1 | DNA-directed RNA polymerase subunit beta | - |
QLQ33_RS13610 (2811689) | 2811689..2812030 | - | 342 | WP_002360937.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
QLQ33_RS13615 (2812030) | 2812030..2812260 | - | 231 | WP_002354773.1 | hypothetical protein | Antitoxin |
QLQ33_RS13620 (2812667) | 2812667..2812882 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
QLQ33_RS13625 (2813021) | 2813021..2814013 | + | 993 | WP_023894581.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
QLQ33_RS13630 (2814277) | 2814277..2814915 | - | 639 | WP_002378863.1 | lytic polysaccharide monooxygenase | - |
QLQ33_RS13635 (2815601) | 2815601..2817217 | + | 1617 | WP_047648929.1 | phosphatase PAP2/LCP family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13165.41 Da Isoelectric Point: 9.3988
>T281687 WP_002360937.1 NZ_CP124908:c2812030-2811689 [Enterococcus faecalis]
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M2A7G9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M2A812 |