Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ImmA-IrrE/HTH_19(antitoxin) |
Location | 1795665..1796358 | Replicon | chromosome |
Accession | NZ_CP124908 | ||
Organism | Enterococcus faecalis strain EfsC33 |
Toxin (Protein)
Gene name | IrrE | Uniprot ID | S4BLV4 |
Locus tag | QLQ33_RS08835 | Protein ID | WP_002378467.1 |
Coordinates | 1796014..1796358 (+) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | ImmA | Uniprot ID | - |
Locus tag | QLQ33_RS08830 | Protein ID | WP_002364355.1 |
Coordinates | 1795665..1795997 (+) | Length | 111 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLQ33_RS08785 (1791137) | 1791137..1791871 | - | 735 | WP_002381724.1 | ERF family protein | - |
QLQ33_RS08790 (1791864) | 1791864..1792181 | - | 318 | WP_002401330.1 | hypothetical protein | - |
QLQ33_RS08795 (1792401) | 1792401..1792955 | + | 555 | WP_002357006.1 | hypothetical protein | - |
QLQ33_RS08800 (1793382) | 1793382..1793576 | - | 195 | WP_002381722.1 | hypothetical protein | - |
QLQ33_RS08805 (1793613) | 1793613..1793822 | - | 210 | WP_002381721.1 | hypothetical protein | - |
QLQ33_RS08810 (1793877) | 1793877..1794065 | + | 189 | WP_002357001.1 | YegP family protein | - |
QLQ33_RS08815 (1794091) | 1794091..1794816 | - | 726 | WP_002381720.1 | phage regulatory protein | - |
QLQ33_RS08820 (1794855) | 1794855..1795166 | - | 312 | WP_002381719.1 | hypothetical protein | - |
QLQ33_RS08825 (1795177) | 1795177..1795353 | - | 177 | WP_002364354.1 | helix-turn-helix transcriptional regulator | - |
QLQ33_RS08830 (1795665) | 1795665..1795997 | + | 333 | WP_002364355.1 | helix-turn-helix transcriptional regulator | Antitoxin |
QLQ33_RS08835 (1796014) | 1796014..1796358 | + | 345 | WP_002378467.1 | ImmA/IrrE family metallo-endopeptidase | Toxin |
QLQ33_RS08840 (1796394) | 1796394..1797122 | + | 729 | WP_002381717.1 | potassium channel family protein | - |
QLQ33_RS08845 (1797222) | 1797222..1798370 | + | 1149 | WP_002381716.1 | site-specific integrase | - |
QLQ33_RS08850 (1798398) | 1798398..1798841 | - | 444 | WP_002381715.1 | competence type IV pilus minor pilin ComGD | - |
QLQ33_RS08855 (1798838) | 1798838..1799113 | - | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | - |
QLQ33_RS08860 (1799113) | 1799113..1800159 | - | 1047 | WP_047649127.1 | competence type IV pilus assembly protein ComGB | - |
QLQ33_RS08865 (1800116) | 1800116..1801084 | - | 969 | WP_002401324.1 | competence type IV pilus ATPase ComGA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1749675..1798814 | 49139 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13712.62 Da Isoelectric Point: 5.5523
>T281674 WP_002378467.1 NZ_CP124908:1796014-1796358 [Enterococcus faecalis]
MKSIKELVEEYEVELVFAPINKRACYEPVKRIIFVNQNLSIEEQEESIFHEFKHVVSHSDYIELYKIPSFRNKMEAEADY
HMFKCLIEKHDGQFNYSNVITHYNLKMGQETYLN
MKSIKELVEEYEVELVFAPINKRACYEPVKRIIFVNQNLSIEEQEESIFHEFKHVVSHSDYIELYKIPSFRNKMEAEADY
HMFKCLIEKHDGQFNYSNVITHYNLKMGQETYLN
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|