Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2633151..2633722 | Replicon | chromosome |
Accession | NZ_CP124906 | ||
Organism | Enterococcus faecalis strain EfsC49 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | QLQ59_RS12660 | Protein ID | WP_229657375.1 |
Coordinates | 2633151..2633444 (-) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | R3JGB1 |
Locus tag | QLQ59_RS12665 | Protein ID | WP_002354773.1 |
Coordinates | 2633492..2633722 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLQ59_RS12655 (2629166) | 2629166..2632780 | - | 3615 | WP_002389470.1 | DNA-directed RNA polymerase subunit beta | - |
QLQ59_RS12660 (2633151) | 2633151..2633444 | - | 294 | WP_229657375.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
QLQ59_RS12665 (2633492) | 2633492..2633722 | - | 231 | WP_002354773.1 | hypothetical protein | Antitoxin |
QLQ59_RS12670 (2633897) | 2633897..2634112 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
QLQ59_RS12675 (2634251) | 2634251..2635243 | + | 993 | WP_002354765.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
QLQ59_RS12680 (2635507) | 2635507..2636136 | - | 630 | WP_002354763.1 | lytic polysaccharide monooxygenase | - |
QLQ59_RS12685 (2636829) | 2636829..2638445 | + | 1617 | Protein_2470 | phosphatase PAP2/LCP family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11226.06 Da Isoelectric Point: 7.9954
>T281662 WP_229657375.1 NZ_CP124906:c2633444-2633151 [Enterococcus faecalis]
IDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETQGQVVISQLKSLDFTERKLSQIEH
LPLKDMAKIDQIIEYIF
IDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETQGQVVISQLKSLDFTERKLSQIEH
LPLKDMAKIDQIIEYIF
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|