Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ImmA-IrrE/HTH_19(antitoxin)
Location 1719368..1720061 Replicon chromosome
Accession NZ_CP124906
Organism Enterococcus faecalis strain EfsC49

Toxin (Protein)


Gene name IrrE Uniprot ID A0A2Z6BTE2
Locus tag QLQ59_RS08460 Protein ID WP_002364356.1
Coordinates 1719717..1720061 (+) Length 115 a.a.

Antitoxin (Protein)


Gene name ImmA Uniprot ID -
Locus tag QLQ59_RS08455 Protein ID WP_002364355.1
Coordinates 1719368..1719700 (+) Length 111 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QLQ59_RS08415 (1715085) 1715085..1715840 - 756 WP_002391449.1 DnaD domain protein -
QLQ59_RS08420 (1715855) 1715855..1716670 - 816 WP_010783770.1 PD-(D/E)XK nuclease-like domain-containing protein -
QLQ59_RS08425 (1716633) 1716633..1717649 - 1017 WP_010783771.1 RecT family recombinase -
QLQ59_RS08430 (1717752) 1717752..1717976 - 225 WP_002391454.1 hypothetical protein -
QLQ59_RS08435 (1717973) 1717973..1718296 - 324 WP_010783772.1 hypothetical protein -
QLQ59_RS08440 (1718336) 1718336..1718551 - 216 WP_010783773.1 hypothetical protein -
QLQ59_RS08445 (1718558) 1718558..1718869 - 312 WP_002381719.1 hypothetical protein -
QLQ59_RS08450 (1718880) 1718880..1719056 - 177 WP_002364354.1 helix-turn-helix transcriptional regulator -
QLQ59_RS08455 (1719368) 1719368..1719700 + 333 WP_002364355.1 helix-turn-helix transcriptional regulator Antitoxin
QLQ59_RS08460 (1719717) 1719717..1720061 + 345 WP_002364356.1 ImmA/IrrE family metallo-endopeptidase Toxin
QLQ59_RS08465 (1720155) 1720155..1721060 + 906 WP_016630909.1 DUF4352 domain-containing protein -
QLQ59_RS08470 (1721120) 1721120..1721194 + 75 Protein_1636 ImmA/IrrE family metallo-endopeptidase -
QLQ59_RS08475 (1721228) 1721228..1721956 + 729 WP_002364358.1 potassium channel family protein -
QLQ59_RS08480 (1722052) 1722052..1723200 + 1149 WP_010783774.1 site-specific integrase -
QLQ59_RS08485 (1723228) 1723228..1723671 - 444 WP_025189979.1 competence type IV pilus minor pilin ComGD -
QLQ59_RS08490 (1723668) 1723668..1723943 - 276 WP_002356991.1 competence type IV pilus major pilin ComGC -
QLQ59_RS08495 (1723943) 1723943..1724989 - 1047 WP_002356990.1 competence type IV pilus assembly protein ComGB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1683655..1742049 58394


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

IrrE N-terminal-like domain

(22-81)

Antitoxin

Cro/C1-type helix-turn-helix domain

(5-63)


Sequences

Toxin        


Download         Length: 115 a.a.        Molecular weight: 13704.62 Da        Isoelectric Point: 5.8535

>T281651 WP_002364356.1 NZ_CP124906:1719717-1720061 [Enterococcus faecalis]
MKSIKELVEEYEVELVFAPINKRACYEPVKRIIFVNQNLSIEEQEESIFHEFKHVVSHSDYMELYKIPSFRNKMEAEADH
HMFKCLIEKHDGQFNYSNVITHYNLKMGQETYLN

Download         Length: 345 bp

Antitoxin


Download         Length: 111 a.a.        Molecular weight: 12691.16 Da        Isoelectric Point: 4.6307

>AT281651 WP_002364355.1 NZ_CP124906:1719368-1719700 [Enterococcus faecalis]
MNLLERIKKLAKDRDVSIYQLEEEINIGRNTIYQWNKRTPSSDKLEAVANYFNVSVDYLLGRTENPNQAGAKPSDDLDEV
LDNVMSFDGEPLDDHDREVIRAYLKGRFGK

Download         Length: 333 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2Z6BTE2

Antitoxin

Source ID Structure

References