Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ImmA-IrrE/HTH_19(antitoxin) |
| Location | 1195364..1196057 | Replicon | chromosome |
| Accession | NZ_CP124905 | ||
| Organism | Enterococcus faecalis strain EfsC85 | ||
Toxin (Protein)
| Gene name | IrrE | Uniprot ID | S4BLV4 |
| Locus tag | QLQ41_RS05495 | Protein ID | WP_002378467.1 |
| Coordinates | 1195364..1195708 (-) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | ImmA | Uniprot ID | - |
| Locus tag | QLQ41_RS05500 | Protein ID | WP_002364355.1 |
| Coordinates | 1195725..1196057 (-) | Length | 111 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLQ41_RS05465 (1190638) | 1190638..1191606 | + | 969 | WP_002364362.1 | competence type IV pilus ATPase ComGA | - |
| QLQ41_RS05470 (1191563) | 1191563..1192609 | + | 1047 | WP_002369171.1 | competence type IV pilus assembly protein ComGB | - |
| QLQ41_RS05475 (1192609) | 1192609..1192884 | + | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | - |
| QLQ41_RS05480 (1192881) | 1192881..1193315 | + | 435 | Protein_1075 | competence type IV pilus minor pilin ComGD | - |
| QLQ41_RS05485 (1193352) | 1193352..1194500 | - | 1149 | WP_002378469.1 | site-specific integrase | - |
| QLQ41_RS05490 (1194600) | 1194600..1195328 | - | 729 | WP_002378468.1 | potassium channel family protein | - |
| QLQ41_RS05495 (1195364) | 1195364..1195708 | - | 345 | WP_002378467.1 | ImmA/IrrE family metallo-endopeptidase | Toxin |
| QLQ41_RS05500 (1195725) | 1195725..1196057 | - | 333 | WP_002364355.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| QLQ41_RS05505 (1196369) | 1196369..1196545 | + | 177 | WP_002364354.1 | helix-turn-helix transcriptional regulator | - |
| QLQ41_RS05510 (1196556) | 1196556..1196867 | + | 312 | WP_002381719.1 | hypothetical protein | - |
| QLQ41_RS05515 (1196906) | 1196906..1197631 | + | 726 | WP_002378466.1 | phage regulatory protein | - |
| QLQ41_RS05520 (1197657) | 1197657..1197845 | - | 189 | WP_002357001.1 | YegP family protein | - |
| QLQ41_RS05525 (1197900) | 1197900..1198109 | + | 210 | WP_002378465.1 | hypothetical protein | - |
| QLQ41_RS05530 (1198146) | 1198146..1198340 | + | 195 | WP_002378464.1 | hypothetical protein | - |
| QLQ41_RS05535 (1198767) | 1198767..1199321 | - | 555 | WP_002357006.1 | hypothetical protein | - |
| QLQ41_RS05540 (1199541) | 1199541..1199858 | + | 318 | WP_002357007.1 | hypothetical protein | - |
| QLQ41_RS05545 (1199851) | 1199851..1200585 | + | 735 | WP_002378463.1 | ERF family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1192908..1241784 | 48876 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13712.62 Da Isoelectric Point: 5.5523
>T281644 WP_002378467.1 NZ_CP124905:c1195708-1195364 [Enterococcus faecalis]
MKSIKELVEEYEVELVFAPINKRACYEPVKRIIFVNQNLSIEEQEESIFHEFKHVVSHSDYIELYKIPSFRNKMEAEADY
HMFKCLIEKHDGQFNYSNVITHYNLKMGQETYLN
MKSIKELVEEYEVELVFAPINKRACYEPVKRIIFVNQNLSIEEQEESIFHEFKHVVSHSDYIELYKIPSFRNKMEAEADY
HMFKCLIEKHDGQFNYSNVITHYNLKMGQETYLN
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|