Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 261466..262037 | Replicon | chromosome |
| Accession | NZ_CP124905 | ||
| Organism | Enterococcus faecalis strain EfsC85 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | QLQ41_RS01235 | Protein ID | WP_002354774.1 |
| Coordinates | 261696..262037 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | R3JGB1 |
| Locus tag | QLQ41_RS01230 | Protein ID | WP_002354773.1 |
| Coordinates | 261466..261696 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLQ41_RS01210 (256840) | 256840..258456 | - | 1617 | WP_002378864.1 | phosphatase PAP2/LCP family protein | - |
| QLQ41_RS01215 (259141) | 259141..259779 | + | 639 | WP_002378863.1 | lytic polysaccharide monooxygenase | - |
| QLQ41_RS01220 (259946) | 259946..260938 | - | 993 | WP_282897387.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
| QLQ41_RS01225 (261077) | 261077..261292 | + | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
| QLQ41_RS01230 (261466) | 261466..261696 | + | 231 | WP_002354773.1 | hypothetical protein | Antitoxin |
| QLQ41_RS01235 (261696) | 261696..262037 | + | 342 | WP_002354774.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| QLQ41_RS01240 (262408) | 262408..266022 | + | 3615 | WP_002389470.1 | DNA-directed RNA polymerase subunit beta | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13156.40 Da Isoelectric Point: 9.3984
>T281640 WP_002354774.1 NZ_CP124905:261696-262037 [Enterococcus faecalis]
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETQGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETQGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|