Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 47596..48167 | Replicon | plasmid p1_EfsC94_repUS11 |
| Accession | NZ_CP124902 | ||
| Organism | Enterococcus faecalis strain EfsC94 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | R3HR30 |
| Locus tag | QLQ35_RS14085 | Protein ID | WP_001278770.1 |
| Coordinates | 47596..47937 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | QLQ35_RS14090 | Protein ID | WP_282861484.1 |
| Coordinates | 47937..48167 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLQ35_RS14065 (QLQ35_14065) | 42686..43162 | - | 477 | WP_080482585.1 | class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI | - |
| QLQ35_RS14070 (QLQ35_14070) | 43676..44875 | - | 1200 | WP_282861477.1 | D-alanyl-lipoteichoic acid biosynthesis protein DltB | - |
| QLQ35_RS14075 (QLQ35_14075) | 45696..46298 | - | 603 | WP_282861479.1 | Fic family protein | - |
| QLQ35_RS14080 (QLQ35_14080) | 46546..47484 | - | 939 | WP_192411295.1 | hypothetical protein | - |
| QLQ35_RS14085 (QLQ35_14085) | 47596..47937 | - | 342 | WP_001278770.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| QLQ35_RS14090 (QLQ35_14090) | 47937..48167 | - | 231 | WP_282861484.1 | AbrB family transcriptional regulator | Antitoxin |
| QLQ35_RS14095 (QLQ35_14095) | 48371..48991 | + | 621 | WP_282861486.1 | recombinase family protein | - |
| QLQ35_RS14100 (QLQ35_14100) | 49008..49295 | + | 288 | WP_173951135.1 | hypothetical protein | - |
| QLQ35_RS14105 (QLQ35_14105) | 49648..50883 | + | 1236 | WP_282861489.1 | AbiH family protein | - |
| QLQ35_RS14110 (QLQ35_14110) | 50960..51088 | - | 129 | WP_282861491.1 | hypothetical protein | - |
| QLQ35_RS14115 (QLQ35_14115) | 51182..51433 | + | 252 | WP_010829212.1 | hypothetical protein | - |
| QLQ35_RS14120 (QLQ35_14120) | 51549..52865 | + | 1317 | WP_161325034.1 | Y-family DNA polymerase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | prgB/asc10 | 1..78787 | 78787 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13220.44 Da Isoelectric Point: 8.8595
>T281635 WP_001278770.1 NZ_CP124902:c47937-47596 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
MSDEKKYIPKKGDIVWIDFDPSAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|