Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907(toxin)
Location 47596..48167 Replicon plasmid p1_EfsC94_repUS11
Accession NZ_CP124902
Organism Enterococcus faecalis strain EfsC94

Toxin (Protein)


Gene name mazF Uniprot ID R3HR30
Locus tag QLQ35_RS14085 Protein ID WP_001278770.1
Coordinates 47596..47937 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID -
Locus tag QLQ35_RS14090 Protein ID WP_282861484.1
Coordinates 47937..48167 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QLQ35_RS14065 (QLQ35_14065) 42686..43162 - 477 WP_080482585.1 class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI -
QLQ35_RS14070 (QLQ35_14070) 43676..44875 - 1200 WP_282861477.1 D-alanyl-lipoteichoic acid biosynthesis protein DltB -
QLQ35_RS14075 (QLQ35_14075) 45696..46298 - 603 WP_282861479.1 Fic family protein -
QLQ35_RS14080 (QLQ35_14080) 46546..47484 - 939 WP_192411295.1 hypothetical protein -
QLQ35_RS14085 (QLQ35_14085) 47596..47937 - 342 WP_001278770.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
QLQ35_RS14090 (QLQ35_14090) 47937..48167 - 231 WP_282861484.1 AbrB family transcriptional regulator Antitoxin
QLQ35_RS14095 (QLQ35_14095) 48371..48991 + 621 WP_282861486.1 recombinase family protein -
QLQ35_RS14100 (QLQ35_14100) 49008..49295 + 288 WP_173951135.1 hypothetical protein -
QLQ35_RS14105 (QLQ35_14105) 49648..50883 + 1236 WP_282861489.1 AbiH family protein -
QLQ35_RS14110 (QLQ35_14110) 50960..51088 - 129 WP_282861491.1 hypothetical protein -
QLQ35_RS14115 (QLQ35_14115) 51182..51433 + 252 WP_010829212.1 hypothetical protein -
QLQ35_RS14120 (QLQ35_14120) 51549..52865 + 1317 WP_161325034.1 Y-family DNA polymerase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - prgB/asc10 1..78787 78787


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(10-112)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13220.44 Da        Isoelectric Point: 8.8595

>T281635 WP_001278770.1 NZ_CP124902:c47937-47596 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF

Download         Length: 342 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8522.43 Da        Isoelectric Point: 4.2412

>AT281635 WP_282861484.1 NZ_CP124902:c48167-47937 [Enterococcus faecalis]
MLTTKSRKQGSSVVLTLPSNNGQKPKADQEYVVMYSDDGTITLVPKLQDPFSGGSEGEYYEKDEWYDIEPGGRELF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB R3HR30

Antitoxin

Source ID Structure

References