Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 2734632..2735203 | Replicon | chromosome |
| Accession | NZ_CP124901 | ||
| Organism | Enterococcus faecalis strain EfsC94 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | QLQ35_RS13320 | Protein ID | WP_048941613.1 |
| Coordinates | 2734632..2734973 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | R3JGB1 |
| Locus tag | QLQ35_RS13325 | Protein ID | WP_002354773.1 |
| Coordinates | 2734973..2735203 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLQ35_RS13315 (2730647) | 2730647..2734261 | - | 3615 | WP_002389470.1 | DNA-directed RNA polymerase subunit beta | - |
| QLQ35_RS13320 (2734632) | 2734632..2734973 | - | 342 | WP_048941613.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| QLQ35_RS13325 (2734973) | 2734973..2735203 | - | 231 | WP_002354773.1 | hypothetical protein | Antitoxin |
| QLQ35_RS13330 (2735377) | 2735377..2735592 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
| QLQ35_RS13335 (2735731) | 2735731..2736723 | + | 993 | WP_002358973.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
| QLQ35_RS13340 (2736987) | 2736987..2737625 | - | 639 | WP_002378863.1 | lytic polysaccharide monooxygenase | - |
| QLQ35_RS13345 (2738313) | 2738313..2739929 | + | 1617 | WP_002372620.1 | phosphatase PAP2/LCP family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13155.37 Da Isoelectric Point: 9.3988
>T281623 WP_048941613.1 NZ_CP124901:c2734973-2734632 [Enterococcus faecalis]
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNISTRYTLPDDIETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNISTRYTLPDDIETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|